KEGG   Paramecium tetraurelia: GSPATT00001675001Help
Entry
GSPATT00001675001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
ptm  Paramecium tetraurelia
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C
Motif
Other DBs
NCBI-GeneID: 5031816
NCBI-ProteinID: XP_001446031
Genoscope: GSPATT00001675001
UniProt: A0D6G7
Position
undetermined
AA seq 154 aa AA seqDB search
MRTRKVQDGQVGFEIRGQSHPKFKRKPQVENPNDIQLDIPNGDLVEGRTYYKTNCGSCHH
LDVDTNLGPSLRTVYLRRFRTNWSMEYGGGDLNSCQKFIWNRKKLWEFLQNPEKMFLDTA
MQQDGINDPFVLASVIDYLQYLRVFTADSKKIVI
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgagaactcgcaaagttcaagatggccaagttggttttgagataagaggttagagccat
cccaaatttaagagaaaaccctaagttgagaacccaaatgacattcaattggatattcca
aacggagatttggttgaaggaagaacttattataaaactaattgtggatcctgtcatcat
ttggacgtggataccaacctaggaccgtcattgagaactgtgtatctaaggagattcaga
acgaattggtctatggaatacggaggaggagatttaaattcttgctaaaaattcatttgg
aacagaaaaaagctatgggaatttctataaaacccagaaaaaatgtttttagatacagcg
atgcaataagatggaatcaatgatccttttgtacttgctagtgtcattgattatcttcaa
tatttaagagtatttactgcagatagcaaaaaaatagttatctga

DBGET integrated database retrieval system