KEGG   Paramecium tetraurelia: GSPATT00002247001Help
Entry
GSPATT00002247001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     GSPATT00002247001
Protein kinases [BR:ptm01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   GSPATT00002247001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 714 aa AA seqDB search
MKSKCNPQDKKLTVIINENNQNISFDLNSNNKPKYYISNTTCHKDNQKFFNCSNMSPMVV
ETSTPRKRLVSGKRTQQKANCSHNNSNNKIQNRQKKSSSNQRTNLTVKTGSSIEALKELM
GKSKCLKQVGYFKQLLQINTDKFKNAKEIQFIETKKSNSSEFGFDNRFNKHFQQLNQQGV
KTTTNKSVSKDRTSLQKVFSKIMDQEKSTSPIKKVDWSKIKLPLTPKDCIQQFGQHLSEF
EKQEIHGFSRIYCIGLKAKKIDQKLSNYNDGFDDSKGEYLYSPNDHIGYRYEILEIVGKG
SFGQAFKVFDHKRQQVQCLKIIRNKKKFTNQALVELNILTYVKEKDEENVTNIVKIKDFV
IFRNHVCISFEFLSINLYQLIKNNNFQSLSLELIRRFAIQILNALNFLSKHKIIHCDLKP
ENILLKQANKSGIKIIDFGSSCFENQKIYSYIQSRYYRAPEVMFGIPYDTSIDMWSFGCI
MAELYLGFPIFPGDDEQEQIAYILEILGMPDNELLQIAQRRKVFFADSLPFQPLCMQNKS
GKLRIPGSKTLSEVLKCNDHNFIDFLKQCLVWNPKNRITPIDALMHVWILEGLPSQIRVQ
HVQYLESQQQYLELNDGKQETNLKQGQQGQQKLQNHHISEPEMNQENKVKPNQIRTISRE
KELLINVSQNPTPNNKKMSQSFHSSKNSNKQQMNFIQQLPGTTKYANKKTHYFY
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctaagtgtaatcctcaagataaaaaacttacggtaataatcaatgagaataat
tagaatatttcttttgatttgaattctaataacaaaccaaaatattatatatcgaacaca
acatgtcacaaagataactaaaagttttttaattgcagcaatatgtcaccaatggttgtt
gaaacatcaactccaagaaaaagacttgtctctggcaaaagaactcagcaaaaggcaaat
tgttctcataataactcaaacaataaaatttaaaatagatagaaaaaatcatcatccaat
tagagaactaatttaactgttaagactggatcatcaattgaagcactgaaagaattaatg
ggaaaaagtaaatgtctaaaataagtaggttacttcaaataactattacaaataaataca
gataaatttaagaatgcaaaagaaatataattcatagaaacaaaaaagagtaactcaagt
gaatttggatttgacaatagattcaataagcatttctagtagttaaatcaacagggtgtt
aaaacaactactaataaatcagtatccaaagacagaacttcattataaaaagtgttctca
aagataatggattaagaaaaatctacatcgcctatcaaaaaggttgattggtccaagatc
aaattgcccttaactccaaaagactgcatacaatagtttggataacacttgagtgaattt
gagaaacaagagatccatggatttagtagaatttattgtataggattaaaggctaaaaaa
attgattagaaattatcaaactacaacgacggctttgatgattcaaaaggtgagtatttg
tattctcctaatgatcatattggatacagatatgagatattagaaatagttggtaaaggt
agttttggataagcattcaaagtatttgatcataaaagacaataagtgcaatgcttaaaa
attataaggaataaaaagaaattcacaaatcaagcattagtagaactaaatattttgacc
tatgtaaaggagaaggatgaagagaatgtaacaaatatagtaaaaataaaagactttgta
atatttagaaatcacgtgtgtatttcttttgaattcttatctataaatttgtattaattg
ataaagaacaataacttttagagtttatctttagaactaattagaagatttgcaattcaa
attttgaatgcattgaacttcttaagcaaacataaaatcatccattgtgacttaaaacct
gagaacattttattaaagcaggcaaataaaagtgggattaaaatcatagactttggaagt
agttgctttgaaaactagaagatttactcttatatttagtcacggtattatagagcacct
gaagttatgtttggtatcccctatgatacaagcatagatatgtggagttttggatgcatt
atggcagaactatatttgggattcccaatatttccaggggatgatgaacaagaacaaatt
gcatacatactagaaatcctgggtatgccagataatgaattgttatagattgcgtaaaga
agaaaggttttctttgctgactctctgcctttttagcctttgtgtatgtaaaataaaagt
ggaaaattgaggatacctggaagtaagacattatcagaggtgttaaaatgcaacgaccat
aatttcatcgatttcttgaaataatgtctagtgtggaatcctaaaaacagaatcactcca
attgatgcccttatgcatgtttggattcttgaaggactacctagtcaaataagagtctag
catgtgtaatatttggaaagttaataacaatatcttgagcttaatgatggaaaataagaa
accaatttaaaatagggtcaacaaggataataaaaattgtagaaccatcacatttcagaa
ccagaaatgaattaagagaataaagtaaaacctaatcagattagaacaatttcaagggag
aaagaacttttgatcaatgtttcatagaatcctactccgaataataagaaaatgtcttaa
tcttttcattctagtaaaaacagcaataaacagcaaatgaatttcattcaataattacca
ggaactacaaaatatgctaacaagaaaactcattatttttattga

DBGET integrated database retrieval system