KEGG   Paramecium tetraurelia: GSPATT00002394001Help
Entry
GSPATT00002394001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00480  Glutathione metabolism
ptm00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GSPATT00002394001
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GSPATT00002394001
Enzymes [BR:ptm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GSPATT00002394001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 5035447
NCBI-ProteinID: XP_001449662
Genoscope: GSPATT00002394001
UniProt: A0DGU8
Position
undetermined
AA seq 183 aa AA seqDB search
MGICSSKKELDKIEVPSKSFFDFEINDIDGNLVQMSKFQGKKAYICVNVACSCRLTTQNY
VELVEMYKQYKDQGLEILGFPCNQFRNQESKPEPEIKNYVTQKYGAHFPLFQKIEVNGVG
AHDIYKYLRYNSELKINNKNEVKYVPWNFAKFLLDANGNVINYYCPDVSPNDMMKDIEKL
LKN
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgggcatttgttcatcaaaaaaagaattagataaaatagaagtaccaagtaaatcattt
ttcgattttgaaataaatgatattgatggcaatctagtttaaatgtcgaaattttaagga
aaaaaagcatatatttgcgtaaatgttgcttgttcttgtcgtttaacaacatagaattat
gttgaattagttgaaatgtataagcaatacaaagattagggtttagaaattctaggtttt
ccatgcaattaatttaggaattaggaaagcaaaccagaaccagaaataaaaaattatgtt
acttaaaaatatggcgctcactttccattattccagaaaatagaagtaaatggggttgga
gctcatgatatttataaatatctacgatataatagtgaattgaagattaataataaaaat
gaagtaaagtatgttccttggaactttgcaaaatttttgcttgacgcgaacggaaacgta
attaactattattgtccagacgttagtccaaatgatatgatgaaagatattgaaaaacta
ttgaagaactga

DBGET integrated database retrieval system