KEGG   Paramecium tetraurelia: GSPATT00002607001Help
Entry
GSPATT00002607001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
ptm  Paramecium tetraurelia
Brite
Protein phosphatases and associated proteins [BR:ptm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     GSPATT00002607001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 152 aa AA seqDB search
MGNTQLTDQQILLYKNETQFTPNQIRRIHKKFQQLDTNNKGFVSAADFIKIIQQHKYSPL
LIQQLIGRKQQEIDFISLVRLLNDIQFGDKNALLTKIMDQDRDGLIGTEDIQKTITVLNP
SCFKNSYELSQQIVNDNEKLTQNRMIKLLIDN
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatacttaattaacggattaatagattcttttatacaagaatgaaacgcaattc
actcctaattaaataagaagaatacacaagaaattctaatagttggacactaacaataaa
ggttttgtgagtgcagctgattttattaaaatcatacaacagcataaatatagcccattg
ttaatttaatagttgattggtcgaaaataacaagaaattgatttcatttcattagttaga
ttattaaatgacatttaatttggggataaaaatgctctattgacaaaaataatggatcaa
gatagagatggattaattggtacggaagacatttagaaaacaataacagtgttaaatcct
agttgtttcaagaattcttatgaattatctcaataaatagttaatgataatgaaaaacta
acataaaatagaatgattaaattattaatagataattga

  All links  
No link information was found.   
DBGET integrated database retrieval system