KEGG   Paramecium tetraurelia: GSPATT00002613001Help
Entry
GSPATT00002613001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00010  Glycolysis / Gluconeogenesis
ptm00020  Citrate cycle (TCA cycle)
ptm00620  Pyruvate metabolism
ptm01100  Metabolic pathways
ptm01110  Biosynthesis of secondary metabolites
ptm01130  Biosynthesis of antibiotics
ptm01200  Carbon metabolism
Module
ptm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSPATT00002613001
   00020 Citrate cycle (TCA cycle)
    GSPATT00002613001
   00620 Pyruvate metabolism
    GSPATT00002613001
Enzymes [BR:ptm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GSPATT00002613001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N DUF515
Motif
Other DBs
NCBI-GeneID: 5038395
NCBI-ProteinID: XP_001452610
Genoscope: GSPATT00002613001
UniProt: A0DQ96
Position
undetermined
AA seq 616 aa AA seqDB search
MLKHALRVMQVFRPKLLHCTPLQTLSIRGPLFTNIPVSYFSTSLPKHKKLEMPALSPTME
TGNIQKYLKKIGDPITAGDVLCEVETDKATVGFEMQDEGFLAQILVPEGSKGVKVGQLVA
VIVPKQSDVAAFANFKDSPNKQPEQSQAASKPASPPQQTPPPQQAASRPTGGALPKHSKL
GLPALSPTMEKGNLMKWLVKEGDQISPGDVICEIETDKATVGFEVQEEGYIAKLMVPAGS
KDIKLGTILAISTPKKDNVSSFANYTLDGAAAPAKTTQAQPAQEQQQSTNSDTPIQTVSQ
SGQRIFVSPLAKEFAKKNNVALEYVKGTGIEGSIVKKDVERFLQSGSKPEVQQQAAISSE
QPIQQTTPPAEAKQQTKPATPSKPVAIEGNPYIDTELTNMRLTIAARLLESKTTIPHYYL
TMTVTMDKVLKVREELNKLQKVKISVNDFIIKASALALKDIPQANSQWHGTYIRKFANAD
ISIAVATDAGLITPIVFNAGSKGLGTIASTVKELADKAKANKLKPQEFIGGTFTISNLGM
FGIDQFIAVINPPQAAILAVGKTSKRFVPDENGQPKVENQMDVTLSCDHRVVDGAVGAQW
LQRFKYYIEDPNTLLL
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagcatgccttaagagtgatgtaagtctttagaccaaaattattgcattgtaca
cctcttcaaacattgtcaataagaggacctctttttactaacattcctgttagttatttc
tctacatccttgccaaagcataagaaattagaaatgcctgctctatcgccaacaatggag
acaggcaatatttagaagtacttaaagaaaataggtgacccaattacagcaggcgatgta
ctctgtgaggttgagactgataaagcaaccgtaggatttgaaatgcaagatgaaggattc
ttagctcaaatccttgtccccgaaggctcaaagggagtcaaagttgggtaattagttgca
gtaattgttccaaagtaatcagatgtggcagcatttgcaaatttcaaagattcgccaaat
aaataacctgagtaaagttaagctgcttcaaagccagcctctccaccataataaacaccg
ccaccttaacaagcagcatctagacccacaggaggtgcacttcctaaacactccaaatta
ggacttccagctttatccccaactatggaaaagggaaatttaatgaaatggcttgttaag
gaaggggattagataagtcctggtgatgtaatttgcgagattgaaacagacaaagctact
gttggatttgaagttcaagaggaaggttacattgcaaaattaatggtaccagctggaagt
aaagatatcaaattaggaactatattggcaatctcaactccaaagaaggataatgtatct
agctttgctaattatactcttgatggtgctgctgcacctgctaaaactacttaagcccaa
ccagcataagaataataataatctaccaatagtgatacaccaatataaacagtttcttaa
tctggttagagaatatttgtttcaccactcgctaaagagttcgcaaaaaagaataatgtt
gctttagagtatgtaaaaggtactggtatagaaggaagcattgtgaaaaaagatgttgag
agatttctttaatctggatcgaaacctgaagtataataataagctgctatttcttcagaa
caaccaatttaataaacaactcctcctgctgaagctaaataataaactaaaccagcaact
ccttcaaaaccagttgctattgaaggcaatccatatattgacacagagcttactaatatg
agattaacaattgctgctagattgttagaatcaaaaacaacaatacctcactattactta
actatgacagttaccatggataaagtcttaaaagtgcgagaagaattaaataaactataa
aaagttaaaatttctgtcaatgatttcataatcaaggcgagtgctttggcattgaaagat
atcccataagctaattcataatggcatggaacatatattagaaaatttgcaaatgctgat
atctccatagctgttgccactgatgctggtctaattactccaattgtttttaacgcaggc
agcaaaggacttggtacaattgcatcaactgtaaaggaattagctgacaaggccaaagct
aataaacttaaaccttaagaatttattggtggcacttttaccatttcaaatctaggaatg
tttggcattgactaatttattgctgttattaatccacctcaagcagctattttagcagtc
ggaaaaacaagtaagagatttgttcctgatgaaaatggctaacctaaggttgaaaactaa
atggatgttacattatcttgtgatcatagagtagttgatggagctgttggtgcataatgg
ttacaaagatttaaatattatattgaggatcctaatacattattgctatga

DBGET integrated database retrieval system