KEGG   Paramecium tetraurelia: GSPATT00002613001Help
Entry
GSPATT00002613001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ptm  Paramecium tetraurelia
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSPATT00002613001
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSPATT00002613001
   00020 Citrate cycle (TCA cycle)
    GSPATT00002613001
   00620 Pyruvate metabolism
    GSPATT00002613001
Enzymes [BR:ptm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GSPATT00002613001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 616 aa AA seqDB search
MLKHALRVMQVFRPKLLHCTPLQTLSIRGPLFTNIPVSYFSTSLPKHKKLEMPALSPTME
TGNIQKYLKKIGDPITAGDVLCEVETDKATVGFEMQDEGFLAQILVPEGSKGVKVGQLVA
VIVPKQSDVAAFANFKDSPNKQPEQSQAASKPASPPQQTPPPQQAASRPTGGALPKHSKL
GLPALSPTMEKGNLMKWLVKEGDQISPGDVICEIETDKATVGFEVQEEGYIAKLMVPAGS
KDIKLGTILAISTPKKDNVSSFANYTLDGAAAPAKTTQAQPAQEQQQSTNSDTPIQTVSQ
SGQRIFVSPLAKEFAKKNNVALEYVKGTGIEGSIVKKDVERFLQSGSKPEVQQQAAISSE
QPIQQTTPPAEAKQQTKPATPSKPVAIEGNPYIDTELTNMRLTIAARLLESKTTIPHYYL
TMTVTMDKVLKVREELNKLQKVKISVNDFIIKASALALKDIPQANSQWHGTYIRKFANAD
ISIAVATDAGLITPIVFNAGSKGLGTIASTVKELADKAKANKLKPQEFIGGTFTISNLGM
FGIDQFIAVINPPQAAILAVGKTSKRFVPDENGQPKVENQMDVTLSCDHRVVDGAVGAQW
LQRFKYYIEDPNTLLL
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgttaaagcatgccttaagagtgatgtaagtctttagaccaaaattattgcattgtaca
cctcttcaaacattgtcaataagaggacctctttttactaacattcctgttagttatttc
tctacatccttgccaaagcataagaaattagaaatgcctgctctatcgccaacaatggag
acaggcaatatttagaagtacttaaagaaaataggtgacccaattacagcaggcgatgta
ctctgtgaggttgagactgataaagcaaccgtaggatttgaaatgcaagatgaaggattc
ttagctcaaatccttgtccccgaaggctcaaagggagtcaaagttgggtaattagttgca
gtaattgttccaaagtaatcagatgtggcagcatttgcaaatttcaaagattcgccaaat
aaataacctgagtaaagttaagctgcttcaaagccagcctctccaccataataaacaccg
ccaccttaacaagcagcatctagacccacaggaggtgcacttcctaaacactccaaatta
ggacttccagctttatccccaactatggaaaagggaaatttaatgaaatggcttgttaag
gaaggggattagataagtcctggtgatgtaatttgcgagattgaaacagacaaagctact
gttggatttgaagttcaagaggaaggttacattgcaaaattaatggtaccagctggaagt
aaagatatcaaattaggaactatattggcaatctcaactccaaagaaggataatgtatct
agctttgctaattatactcttgatggtgctgctgcacctgctaaaactacttaagcccaa
ccagcataagaataataataatctaccaatagtgatacaccaatataaacagtttcttaa
tctggttagagaatatttgtttcaccactcgctaaagagttcgcaaaaaagaataatgtt
gctttagagtatgtaaaaggtactggtatagaaggaagcattgtgaaaaaagatgttgag
agatttctttaatctggatcgaaacctgaagtataataataagctgctatttcttcagaa
caaccaatttaataaacaactcctcctgctgaagctaaataataaactaaaccagcaact
ccttcaaaaccagttgctattgaaggcaatccatatattgacacagagcttactaatatg
agattaacaattgctgctagattgttagaatcaaaaacaacaatacctcactattactta
actatgacagttaccatggataaagtcttaaaagtgcgagaagaattaaataaactataa
aaagttaaaatttctgtcaatgatttcataatcaaggcgagtgctttggcattgaaagat
atcccataagctaattcataatggcatggaacatatattagaaaatttgcaaatgctgat
atctccatagctgttgccactgatgctggtctaattactccaattgtttttaacgcaggc
agcaaaggacttggtacaattgcatcaactgtaaaggaattagctgacaaggccaaagct
aataaacttaaaccttaagaatttattggtggcacttttaccatttcaaatctaggaatg
tttggcattgactaatttattgctgttattaatccacctcaagcagctattttagcagtc
ggaaaaacaagtaagagatttgttcctgatgaaaatggctaacctaaggttgaaaactaa
atggatgttacattatcttgtgatcatagagtagttgatggagctgttggtgcataatgg
ttacaaagatttaaatattatattgaggatcctaatacattattgctatga

DBGET integrated database retrieval system