KEGG   Paramecium tetraurelia: GSPATT00003455001Help
Entry
GSPATT00003455001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     GSPATT00003455001
Peptidases [BR:ptm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   GSPATT00003455001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 326 aa AA seqDB search
MGVTQSSQNDHLEKYLGQDFPDGEILIGFENPSNICYSNVILQALYYCKEFKNQILQHQS
SINQNNLLDLTKLLFQSISKHKQKTGVISTKKMMNYIKTKNKIFDGKYHQDSHEFYMWFI
NECEELLKDKQNNWVRQIFQGQQLTQIECLNCHSISQREEMYCDLSLDLFPNYSLSTCLQ
QMSKEEQLNGQNQFFCDKCQSKQDAIKRLLLNTLPNVLVVHLKRFKYDERCGQMIKVSSK
IPFSQQLSIKALKQTKTYELTTIIIHLGQGILYGHYVCITKIQGKWFKFDDDKISLFVDQ
DLHFVYGRSYPTHAQTCAYMLFYNAQ
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggagtaacataatctagttaaaatgatcatttagaaaaatatttaggataagatttt
ccagatggggaaattttaattggatttgaaaatccaagtaatatttgttattcaaatgta
atattataagcattgtattattgcaaagaatttaagaattaaattttataacatcagagc
tcaattaattagaataatttactagatttaactaaattgttattccaatcaatatcaaaa
cacaaacagaagactggagtaatttcaaccaaaaagatgatgaattatattaaaactaaa
aataaaattttcgatggcaagtatcattaagattctcatgaattttacatgtggtttatt
aatgaatgcgaagaattattgaaggataaacaaaataattgggttagataaatatttcag
ggatagtaattaacataaatcgagtgcttaaattgccattcaatctcttaaagagaggaa
atgtattgtgatttatccttagacttatttcctaattatagtttgagcacttgtttgtaa
taaatgtcgaaagaagaacagctaaatggttagaatcaattcttttgcgataagtgtcaa
tctaaataagatgctataaaaagattattgttgaatactctaccaaatgtcttagtagtc
catctgaaacgatttaaatatgatgagagatgtgggtagatgattaaagtgtcttcaaag
attcccttttctcaataattaagtattaaggctctgaaataaacaaagacctacgaattg
actacaatcattatccacttaggataaggcatattgtatggtcattatgtgtgtataaca
aaaatacaagggaaatggtttaaatttgatgatgataaaatatctctatttgttgattaa
gatttacattttgtttatggaagaagttatccaactcatgctcaaacatgtgcatatatg
ctgttttataatgcataatga

DBGET integrated database retrieval system