KEGG   Paramecium tetraurelia: GSPATT00004874001Help
Entry
GSPATT00004874001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     GSPATT00004874001
Protein kinases [BR:ptm01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   GSPATT00004874001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 429 aa AA seqDB search
MQDAQKLQKLSQLPKNFSDWQVGDDYEIIRQIGSGSYGQVVEAMQKSINRKVAIKRLTAI
FDDEIDCKRILREICILRELKHQNLIQIIEILEPQDPKSFDTIYVVMEYAQSDLKKLFKS
PIHLQFLHIQTIVYNICVGLKYLHSAKVLHRDLKPANVLLNEDCTVKICDFGLARSVQGI
DATDQALEEELARQQEEPKKKDEKKGPRMLQKQNKLNAKAVKRELTGHVVTRWYRAPEVI
LLEKDYTAAIDVWSVGCIFAELLNMMKENAPTFLDRAPLFPGTSCFPLSPERSAIAKKGG
FPYSNTDQLTVIFSVLGTPGDKDMDFVTDKKAIEYLKSFPKKPKVAFVEIFPGAPPEALD
FLDKCLQLSPKIRITLDQAIEHPMLQKVRDKKKEIVAPGPIYLDFEQEGDLQIPRLRELF
LREISKYKR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtaagacgcttagaaactttaaaaattatcttaacttccaaaaaacttttcagattgg
caagttggtgatgattacgagataatacgataaataggatcgggatcttatgggtaagtt
gtagaagctatgcaaaaatctattaatcggaaagtcgctattaagagattgacagcaata
tttgatgatgaaattgactgtaaaagaattttaagggaaatttgcatcttgagggaattg
aagcatcagaatttaattcaaatcatagaaattctagaaccataagatccgaaatcattt
gatacaatatatgttgttatggagtatgctcaaagcgacttaaaaaaattattcaaatcc
ccaatccacttataatttctgcacatccaaaccattgtttataatatatgtgtaggtctt
aaatatttacattctgctaaggttttgcatagagacttaaagccagcaaatgttctatta
aatgaagattgcactgttaagatttgcgattttggattggccagaagtgttcaaggaatt
gatgctactgattaggcattagaagaagaacttgctaggcaataggaagagcctaaaaag
aaagatgagaaaaaaggtcctagaatgctgtaaaaataaaacaaattaaacgccaaagct
gtaaaaagagagttaactggtcatgtagtaacaagatggtatagagccccagaagttatt
ctcttggaaaaagattatactgcagctattgatgtttggtctgttggttgtatttttgct
gagttgttaaatatgatgaaagaaaatgcaccaacatttttagatagagctcctctattt
cctggaaccagttgttttccacttagtccagaaagaagtgctatagctaagaaaggagga
tttccatattcgaatactgattaactcacagttatcttttctgtattaggaacccctgga
gacaaggatatggattttgtaactgataaaaaagctatagaatatttgaagagttttccc
aaaaaacctaaggttgcatttgtagaaatatttccaggagctcctcctgaggcgttggat
tttttagataagtgtctataattaagtccaaaaataagaatcactttggatcaagctatt
gaacatcctatgctttaaaaagtcagggataaaaagaaagaaatcgttgctcctggacct
atatatttagatttcgaataagaaggtgatttataaattccgagattaagagagttattt
ttaagagaaatttcaaagtataaacgttga

DBGET integrated database retrieval system