KEGG   Paramecium tetraurelia: GSPATT00004874001Help
Entry
GSPATT00004874001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ptm  Paramecium tetraurelia
Pathway
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    GSPATT00004874001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     GSPATT00004874001
Protein kinases [BR:ptm01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   GSPATT00004874001
Chromosome [BR:ptm03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     GSPATT00004874001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GSPATT00004874001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 429 aa AA seqDB search
MQDAQKLQKLSQLPKNFSDWQVGDDYEIIRQIGSGSYGQVVEAMQKSINRKVAIKRLTAI
FDDEIDCKRILREICILRELKHQNLIQIIEILEPQDPKSFDTIYVVMEYAQSDLKKLFKS
PIHLQFLHIQTIVYNICVGLKYLHSAKVLHRDLKPANVLLNEDCTVKICDFGLARSVQGI
DATDQALEEELARQQEEPKKKDEKKGPRMLQKQNKLNAKAVKRELTGHVVTRWYRAPEVI
LLEKDYTAAIDVWSVGCIFAELLNMMKENAPTFLDRAPLFPGTSCFPLSPERSAIAKKGG
FPYSNTDQLTVIFSVLGTPGDKDMDFVTDKKAIEYLKSFPKKPKVAFVEIFPGAPPEALD
FLDKCLQLSPKIRITLDQAIEHPMLQKVRDKKKEIVAPGPIYLDFEQEGDLQIPRLRELF
LREISKYKR
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtaagacgcttagaaactttaaaaattatcttaacttccaaaaaacttttcagattgg
caagttggtgatgattacgagataatacgataaataggatcgggatcttatgggtaagtt
gtagaagctatgcaaaaatctattaatcggaaagtcgctattaagagattgacagcaata
tttgatgatgaaattgactgtaaaagaattttaagggaaatttgcatcttgagggaattg
aagcatcagaatttaattcaaatcatagaaattctagaaccataagatccgaaatcattt
gatacaatatatgttgttatggagtatgctcaaagcgacttaaaaaaattattcaaatcc
ccaatccacttataatttctgcacatccaaaccattgtttataatatatgtgtaggtctt
aaatatttacattctgctaaggttttgcatagagacttaaagccagcaaatgttctatta
aatgaagattgcactgttaagatttgcgattttggattggccagaagtgttcaaggaatt
gatgctactgattaggcattagaagaagaacttgctaggcaataggaagagcctaaaaag
aaagatgagaaaaaaggtcctagaatgctgtaaaaataaaacaaattaaacgccaaagct
gtaaaaagagagttaactggtcatgtagtaacaagatggtatagagccccagaagttatt
ctcttggaaaaagattatactgcagctattgatgtttggtctgttggttgtatttttgct
gagttgttaaatatgatgaaagaaaatgcaccaacatttttagatagagctcctctattt
cctggaaccagttgttttccacttagtccagaaagaagtgctatagctaagaaaggagga
tttccatattcgaatactgattaactcacagttatcttttctgtattaggaacccctgga
gacaaggatatggattttgtaactgataaaaaagctatagaatatttgaagagttttccc
aaaaaacctaaggttgcatttgtagaaatatttccaggagctcctcctgaggcgttggat
tttttagataagtgtctataattaagtccaaaaataagaatcactttggatcaagctatt
gaacatcctatgctttaaaaagtcagggataaaaagaaagaaatcgttgctcctggacct
atatatttagatttcgaataagaaggtgatttataaattccgagattaagagagttattt
ttaagagaaatttcaaagtataaacgttga

DBGET integrated database retrieval system