KEGG   Paramecium tetraurelia: GSPATT00006138001Help
Entry
GSPATT00006138001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
ptm  Paramecium tetraurelia
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ptm04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 451 aa AA seqDB search
MASSKKQKKKINNQLSKKKTIRTNIRKTKCDQLAQYVKKFQNQFKLNQLDSDKQEIIPSY
QSIPTSYQLKGKKKFQKKEAVKGLVGLKNLGNKCYMNASIQLLSNLQPLSDYFIEDFQLT
EINRKNPISTQGLATVAFANLIKSLWQMDIQKLTVKGTPIIIPEEFNKIIGYCNKSFSDN
TQQDAQEFLMYLLDMIHEDLNRVTFPIKSVQLREYSGDCNQRELEKQAAETWGDYLQRSK
SIIVDLMQGQFKNSLKCLSCDNYTYKFEPLMYLSVPIPESEECQLIECIKEYVKEEQLTN
GNQWFCENCHKLVDAIKKIDLWKLPTILIIHLKRFKFIENGIKKIEQAINFPMESLNLSQ
CLPKLQKEKPIYELLGVICHTGTSDRGHYYTYARSKENFNWYLFNDRQVKQVNFTEIPQE
DAYLLMYGKSTIPLIKRQTISFPENWPHVIK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttctaaaaaataaaagaaaaagataaataattaattgagtaaaaaaaagacg
ataaggactaatatcagaaaaacaaagtgtgattagttggctcaatatgtgaagaaattc
tagaattaatttaagttaaattaattagattcagacaaataggagatcattccttcatat
tagagcattcctacaagttattagcttaaagggaaaaagaagtttcaaaagaaggaagca
gtaaaaggactggtgggattgaaaaacttgggaaataagtgttatatgaatgcgtcgata
taattacttagtaatctgcagccattatcagattattttattgaagatttccaattaaca
gagattaatcgaaagaatccgatctccacgtaaggtttagcaactgtagcatttgccaac
ctaataaagagtctctggcaaatggacattcagaaactcaccgtcaagggaacaccaatt
attatacctgaggaattcaacaagattattgggtattgcaataagtccttttcagacaat
acacaataagatgcttaggaatttctgatgtatttgcttgacatgatacatgaggatctg
aacagagtaacatttccgatcaagagtgtgcaattgagagaatactctggagattgtaat
tagagagagttagagaaataagcagcagaaacttggggtgattatctacaacgaagcaaa
tctataatagtagatctaatgcaaggacaattcaagaactcattgaaatgtttgagttgc
gataattacacctataaatttgagcctttgatgtatttgagtgttccgatcccagaatct
gaggaatgctaattaatcgaatgcataaaggagtatgtcaaagaggagtagttgacaaat
gggaattaatggttttgtgagaattgtcataagctagtggatgcgataaagaagatagat
ttgtggaaattacctactattctaataatccatcttaagagatttaaatttatagagaat
ggaattaagaaaattgaataggcaatcaacttccctatggagagtttgaacttaagttag
tgcttaccgaaactgtaaaaagaaaagcctatctatgaattattaggagttatttgccat
accggaacaagtgatagaggtcactattacacatacgcaagaagcaaagagaattttaat
tggtatctatttaacgacaggtaagtcaagtaagtgaatttcactgagatacctcaagaa
gatgcctacctattgatgtatggcaaaagcacaatcccattgatcaaacgtcaaactatt
tcatttcctgaaaattggcctcatgtaataaaatga

DBGET integrated database retrieval system