KEGG   Paramecium tetraurelia: GSPATT00006379001Help
Entry
GSPATT00006379001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     GSPATT00006379001
Protein kinases [BR:ptm01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   GSPATT00006379001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GSPATT00006379001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 376 aa AA seqDB search
MNPDPKSLNIPKGRHSFQCGGQTFVVDQKYEYIKQIGHGAYGVVCSAQNKRTGQKVAIKK
VANAFDDLIDGKRIVREIKLLKFFKHENIISLFDVQKPEAKTGFNDIYIVTEFMETDLHR
VIYSRQELTDEHIQYFVYQILRGLLYMHSANVIHRDLKPGNILVNKNCDLKICDLGLARG
YENEEDFKTEYVVTRWYRAPEVILNASEYSKAVDIYSVGCILAELLGRTPLFPGENYLDQ
VQRIIAVLGTPTADDMKYIGNNNAIKYIKSLPKRSKQKWEALFPKANNKALDLLGKMITF
NPEQRYTVEQCLQHPYFDELHNPDEEPLSGKAFDWSWDNFDPTKELLQNMIYQESLSFND
EVPERKKKSNQFQLKA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgaatccagatcctaaaagtcttaatatccctaagggaagacattcgttttaatgtgga
ggccaaacctttgtagtcgatcaaaaatatgaatatataaaacagattggacatggagcc
tatggagttgtatgttctgctcaaaataagagaactgggtagaaggtagcaataaaaaaa
gtcgctaatgcatttgatgatttgatcgacggcaaaaggatagttagagaaatcaaatta
ctaaaattttttaaacatgagaatatcatttcactctttgatgttcaaaagcctgaagca
aaaacaggatttaatgatatttacattgtaaccgaatttatggaaacagatttacataga
gtcatatactctaggtaagaactgacagatgagcacattcaatattttgtttactagatc
ctaagaggattactttacatgcattcagccaacgtaattcatcgcgatctcaaaccaggt
aatattttagttaacaaaaattgtgatttaaaaatatgcgatttaggcttagcaagagga
tatgaaaacgaggaagacttcaaaacagaatacgttgttactagatggtatagagctcct
gaagttattttgaatgcatctgaatacagtaaggcagtcgacatttactctgttggttgt
atcttggctgaattattgggaaggactcctttattcccaggcgaaaactatttagattaa
gtttagagaatcattgcagtcttaggaactcctactgctgacgatatgaaatacattgga
aacaataacgcaattaaatacattaaaagtcttcccaaaagatctaaatagaagtgggaa
gctcttttccctaaggcaaataacaaagctctagatttgttaggaaagatgatcacattc
aacccagaacaacgttatactgttgaataatgtcttcagcatccttactttgatgaattg
cataatcctgatgaagaacccctgagtggcaaagcctttgattggagttgggataatttc
gacccaaccaaagaattactttaaaatatgatctatcaagaatccctctcctttaatgat
gaagttcctgaaagaaagaaaaagtcaaattaattctaattgaaagcttga

DBGET integrated database retrieval system