KEGG   Paramecium tetraurelia: GSPATT00006707001Help
Entry
GSPATT00006707001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
ptm  Paramecium tetraurelia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 706 aa AA seqDB search
MKSKYNPQEKKLTVTIIMINQNISYDLNSNNKPKYYISNTTCHKENQKFFNGSNMSPLVV
ESSTPRKRLISGKRTQQKANCSNNNSNNKIQNRQKKSSSNQRTNLTVKTGSSIEALKELM
GKSNLKQLLQINTDKFKNAKEISFIETKKSNSSEFGYDNRFNKHFQQYNQYGIKTTTNKS
GSKDRTTLQKVFSKIIDQEKSVSPSKKVDWSKTKLPLTPKECIQQFGQYLTDFEKQEIHG
FIQIYCIGMTSKKIDQKQSNCNDGFDDSNGEYLFSPNDHIGYRYEILEIVGKGSFGQAFK
VFDHKRQQVQCLKIIRNKKKFTNQALVELNILTYIKEKDEDNVTNIVKIKDFVIFRNHVC
ISFEFLSINLYQLIKNNNFQSLSLELIRRFAIQILNALNFLNKHKIIHCDLKPENILLKQ
ENKSGIKIIDFGSSCFENQKIYSYIQSRYYRAPEVMFGIPYDTNIDMWSFGCIMAELYLG
YPIFPGDDEQEQIAYILEILGMPDNELLEIAQRRKVFFNDSPPYQPLCMQNKGAKLKVPG
SKTLSAVLQCKDDNFIDFLKQCLVWNPKNRISPINALMHVWILDGLPSQIRAQHVQYLES
QLQCMDSNYKKQETNFKQGQQGQQKLPIHHISEPEMNQENKKPNQIRTFSRDKELLLNIS
QNPTPNNKKISQSFHSSKNSNKQQLNFIQQFPGTTKYTNKKTHYFY
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctaagtataatccttaagaaaaaaaactgacggtaacaatcataatgattaac
tagaatatttcttatgatttgaattcaaataacaaaccaaaatattatatatcgaacaca
acatgccacaaagaaaaccaaaagttttttaatggcagcaatatgtcaccattagttgtt
gaatcatctactccaagaaaaagacttatatctggcaaacgaacctagcaaaaagcgaat
tgttctaataataactcaaacaataaaatttaaaatagatagaaaaaatcgtcatccaat
tagagaactaatttaactgttaagactggatcatcgattgaagcacttaaggaattgatg
gggaaaagtaacttgaaatagctattacaaattaatacagataaattcaagaatgcaaaa
gaaatatcattcatagagacaaaaaagagtaactcaagtgaatttggatatgacaataga
ttcaataaacatttctaataatataattaatatggtattaaaacaacaacaaataagtca
ggatcaaaagatagaactacattataaaaagtattctcaaaaattattgatcaagaaaaa
tctgtgtctccttccaaaaaggttgattggagcaaaactaagttgcctttaacaccaaaa
gaatgcatataataatttggataatatttgacggattttgagaaataagaaattcatgga
tttatttagatttattgcataggaatgacatctaaaaagatagatcaaaaataatcaaat
tgcaatgacggttttgatgattcaaatggtgagtatttgttttcacctaatgatcacatt
ggatacagatatgagattttggagatagttggcaaaggtagttttggataagcattcaaa
gtctttgatcataagagataataagtgtaatgcttaaagattatcagaaacaaaaagaag
tttacaaattaagctttagtagaattaaacatattaacatatatcaaggagaaggatgag
gataatgttacaaatatcgtaaaaataaaggattttgtaatttttagaaatcatgtgtgt
atttcctttgaattcttgtcgataaacttgtattagttgataaagaacaataatttttaa
agtttatccttggagctcataaggagatttgcaatttaaattctaaatgcattgaatttt
ttaaacaaacataaaatcatccattgtgacttaaaacctgagaatatattattaaagtaa
gaaaacaaaagcgggattaaaatcatagactttggcagtagttgtttcgaaaattaaaag
atctactcttatattcagtcacggtattatagagcccctgaagtaatgtttggtatcccg
tatgatacgaatatcgatatgtggagttttggatgtattatggcagaactgtatttggga
tacccaatatttccaggagatgatgaataagagcaaatagcatatattttagaaatccta
ggtatgccagataatgaactcttagaaatcgcctaaagaagaaaagttttctttaatgac
tctcctccttattaaccattgtgtatgtagaataaaggggctaaattaaaagtacctgga
agcaaaacattatcagcggtcttacaatgtaaggatgacaattttattgacttcttaaaa
taatgtttagtttggaatccgaaaaataggatcagcccaatcaatgctctaatgcatgtt
tggatacttgatggattacctagtcaaattagagctcagcacgtataatatttagaaagt
taattacaatgcatggattccaattataaaaaataagaaactaatttcaaacagggttaa
tagggataataaaaactacctatccatcatatctcagaaccagaaatgaattaagaaaat
aaaaaacctaatcagattagaaccttttcaagagataaagagttattgcttaatatttca
tagaatcctactcctaataataagaaaatttctcagtcttttcattccagcaaaaacagc
aataagcaacaattgaattttattcaataattccctgggactacaaaatatactaacaag
aaaactcattatttttattga

DBGET integrated database retrieval system