KEGG   Paramecium tetraurelia: GSPATT00007193001Help
Entry
GSPATT00007193001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K08823  CDC-like kinase [EC:2.7.12.1]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     GSPATT00007193001
Protein kinases [BR:ptm01001]
 Serine/threonine kinases: CMGC group
  CLK family
   GSPATT00007193001
Spliceosome [BR:ptm03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    GSPATT00007193001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr SR-25 Kdo Macoilin AF-4
Motif
Other DBs
NCBI-GeneID: 5022163
NCBI-ProteinID: XP_001436378
Genoscope: GSPATT00007193001
UniProt: A0CDW4
Position
undetermined
AA seq 390 aa AA seqDB search
MSSSSSSSSSRSSSRSSSSSSSSSSRYSHKKQKRKNKKKEDQDAGHFEYQIGMKIKAGQF
MITRFLGDGTFGRVLEVKTCNTANNNYYAMKCIRAVERYIESAKIETKILWYIQDKDKSG
AFNIVRLFTSFERYNNYFMVFERLGKSLYDLIKQNNYIGFPMKYVQSFAKQIIISVAFLH
QNQITHTDLKPENILTTNCEYKLVPFKGRQIWVPEKEILKIIDLGGATFEHEYHSTVINT
RQYRAPEVIMGYPKWNERSDIWCLACVLLELYTGELYFQNKDDLEHIAMIEKAIGPMDYR
HFKNSKYKTFFNYDQKYFDQHRSYFKWNSVAPSDSAIERVKKLKTFEELIPAKHAIFIDL
IRKMLRIDPEERIPLRKLVHHPFFQQVFQD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagttcttcctctagttcctcatcttcaaggtcttcatcaagatcatcatcctcaagt
tcatcatcttcatctagatactctcacaaaaaatagaaaagaaaaaacaaaaagaaagag
gattaagatgctggccattttgaatatcaaataggcatgaaaataaaagcaggataattt
atgataacacggtttttaggagatggcacctttggtcgtgttttagaagttaaaacctgt
aatactgctaataataattattatgccatgaaatgcataagggctgtagaaaggtacata
gaatcagccaaaatcgaaaccaaaatattgtggtatatataggataaggataagagtggg
gcatttaatattgtgaggctgtttacatcgtttgaaagatataacaattatttcatggtt
ttcgagaggttagggaaatcattatatgacttaataaaacagaacaattacatcggtttt
cctatgaaatatgtgtaatcatttgctaaatagatcatcatctcagtggctttccttcat
caaaattagataactcatacagatctcaaacctgaaaatatcttaactacaaattgtgaa
tataagttggtccccttcaaaggaagacaaatatgggttcctgaaaaagaaatccttaaa
attatagatcttgggggcgccacctttgaacatgaatatcacagtactgtcattaacaca
agacaatatcgtgctcctgaagtgattatgggctatccaaaatggaatgagaggagtgat
atttggtgcttagcttgtgtcttattagaattgtataccggcgaattgtatttctaaaat
aaagatgatttagaacacatagccatgatcgaaaaagctattggacctatggattaccgt
catttcaagaactccaaatataaaacattcttcaattatgattaaaagtactttgattaa
catcgatcatatttcaaatggaattctgtggcaccaagtgattctgcaatagaaagagtt
aaaaaattgaaaacttttgaagaattaataccagctaaacatgccatttttattgatctg
attagaaaaatgcttagaatagatcctgaagaaagaatacctttgagaaaactagttcat
catcccttttttcaataggtattttaagattga

DBGET integrated database retrieval system