KEGG   Paramecium tetraurelia: GSPATT00007193001Help
Entry
GSPATT00007193001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
ptm  Paramecium tetraurelia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 390 aa AA seqDB search
MSSSSSSSSSRSSSRSSSSSSSSSSRYSHKKQKRKNKKKEDQDAGHFEYQIGMKIKAGQF
MITRFLGDGTFGRVLEVKTCNTANNNYYAMKCIRAVERYIESAKIETKILWYIQDKDKSG
AFNIVRLFTSFERYNNYFMVFERLGKSLYDLIKQNNYIGFPMKYVQSFAKQIIISVAFLH
QNQITHTDLKPENILTTNCEYKLVPFKGRQIWVPEKEILKIIDLGGATFEHEYHSTVINT
RQYRAPEVIMGYPKWNERSDIWCLACVLLELYTGELYFQNKDDLEHIAMIEKAIGPMDYR
HFKNSKYKTFFNYDQKYFDQHRSYFKWNSVAPSDSAIERVKKLKTFEELIPAKHAIFIDL
IRKMLRIDPEERIPLRKLVHHPFFQQVFQD
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgagttcttcctctagttcctcatcttcaaggtcttcatcaagatcatcatcctcaagt
tcatcatcttcatctagatactctcacaaaaaatagaaaagaaaaaacaaaaagaaagag
gattaagatgctggccattttgaatatcaaataggcatgaaaataaaagcaggataattt
atgataacacggtttttaggagatggcacctttggtcgtgttttagaagttaaaacctgt
aatactgctaataataattattatgccatgaaatgcataagggctgtagaaaggtacata
gaatcagccaaaatcgaaaccaaaatattgtggtatatataggataaggataagagtggg
gcatttaatattgtgaggctgtttacatcgtttgaaagatataacaattatttcatggtt
ttcgagaggttagggaaatcattatatgacttaataaaacagaacaattacatcggtttt
cctatgaaatatgtgtaatcatttgctaaatagatcatcatctcagtggctttccttcat
caaaattagataactcatacagatctcaaacctgaaaatatcttaactacaaattgtgaa
tataagttggtccccttcaaaggaagacaaatatgggttcctgaaaaagaaatccttaaa
attatagatcttgggggcgccacctttgaacatgaatatcacagtactgtcattaacaca
agacaatatcgtgctcctgaagtgattatgggctatccaaaatggaatgagaggagtgat
atttggtgcttagcttgtgtcttattagaattgtataccggcgaattgtatttctaaaat
aaagatgatttagaacacatagccatgatcgaaaaagctattggacctatggattaccgt
catttcaagaactccaaatataaaacattcttcaattatgattaaaagtactttgattaa
catcgatcatatttcaaatggaattctgtggcaccaagtgattctgcaatagaaagagtt
aaaaaattgaaaacttttgaagaattaataccagctaaacatgccatttttattgatctg
attagaaaaatgcttagaatagatcctgaagaaagaatacctttgagaaaactagttcat
catcccttttttcaataggtattttaagattga

DBGET integrated database retrieval system