KEGG   Paramecium tetraurelia: GSPATT00007691001Help
Entry
GSPATT00007691001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
ptm  Paramecium tetraurelia
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GSPATT00007691001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     GSPATT00007691001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 410 aa AA seqDB search
MLKNLLIVFLYSLLIAVKAENVLTIAFGSCFKFYRSHDTDVFLRIQQFNPQYFLWLGDAA
YIDYSHTRVKDKFDITNNDKYYAQFKKSVTIKGIYDDHDSNQNNGDKFNPFKESAKQLYL
DFIGVDNNSPLRKQDGIYQSFYADQDNQILIVMTDIRYNSDKQTGDSLGENQWKWLEEQF
KKKSELIIMTSGIQVMPDDRDGSETWFKWSKKRLYTLIKKYNKPIIFLSGDVHYSEIMKY
PCPHRLGQNLYEFTSSGMTFANSDHIPFFGFISQFFRPTTFSNNQDHYYKSNFGILKVIT
NNRNSPVRIDYETHSSDDSSVVLQKTIYIEELQQQFYDDSQSCILDVYREERQWQNYLLR
INESIFIVSCSLLAVLLFIIFLIYNFISYISKFLELYKQIQMNKLKIKQE
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaaaacttattaattgtttttttgtattctcttcttattgctgtgaaggctgag
aatgtattaactatagcatttggctcatgctttaaattttatagatctcatgacacagat
gtttttctaagaatttagtagtttaatccataatattttttatggttgggagacgctgct
tatattgattattctcatactagagtaaaagataaatttgacatcaccaacaatgataaa
tattatgctcaattcaaaaagagtgtaacaatcaaaggaatttatgatgaccatgatagt
aattaaaataatggagataaattcaaccctttcaaagaaagtgcaaaataattatatcta
gattttattggtgtagacaataattctccccttagaaaataggatggcatttactaatca
ttctatgctgatcaagataatcagattctaattgttatgacagatataagatataattcc
gataaataaacaggtgattccttaggagaaaattaatggaaatggttagaagaataattt
aagaaaaaaagcgaattgatcatcatgacatctggaatctaagttatgcctgatgataga
gatggatcagaaacatggtttaaatggtctaaaaagagattatatactttaatcaaaaaa
tataataagcctatcatcttcttatctggagatgtgcactattctgaaattatgaaatat
ccatgtccccataggttaggttaaaatctctatgaatttacttcaagtggaatgacattt
gctaattctgatcatattcccttttttggctttatttcctaattttttcgtccaacaact
tttagtaacaattaagatcactattacaaatcgaattttggaatcttaaaagtaattact
aataatcgaaattcacctgtaaggattgattatgaaactcattctagtgatgactctagt
gttgttttgtagaagactatctatattgaagagctacaacaataattttatgatgactct
tagtcttgtatattagatgtatatagagaagagagataatggtagaattatttattgaga
attaatgaaagcatttttatagtgagttgctcgctattggcagtattgttattcattata
tttttgatatataattttatatcctatatttctaaatttttagaattatataaacagata
tagatgaataaattaaaaattaaataagaatga

DBGET integrated database retrieval system