KEGG   Paramecium tetraurelia: GSPATT00008656001Help
Entry
GSPATT00008656001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00250  Alanine, aspartate and glutamate metabolism
ptm01100  Metabolic pathways
ptm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    GSPATT00008656001
Enzymes [BR:ptm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     GSPATT00008656001
Peptidases [BR:ptm01002]
 Cysteine Peptidases
  Family C44
   GSPATT00008656001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 DUF3700 NAD_synthase
Motif
Other DBs
NCBI-GeneID: 5025397
NCBI-ProteinID: XP_001439612
Genoscope: GSPATT00008656001
UniProt: A0CN48
Position
undetermined
AA seq 590 aa AA seqDB search
MCGILAILNVKGTEVQVRAKAYELSRRIRHRGPDRSKIIEISPGLYHVISHERLGLVDLS
DKGRQPFRMVDDENIIFMQNGELYDYWDVRPELEKKYRFSSNSDTEIVGMLYKEYGAGNF
WNHLNGMFATVLIDMSKKSFQAGRDHIGIVPLYYGFNEDGSLFLSSELKGIHDQVIEVKQ
FPPGYIYIYNIQTYEIKRWYNPIWNNFDHIPTGEIDFQVLRDKFVEVVRREIQGDAPFGL
FISGGVDSSIVAGIVAKLIKRGEIDLSKRGMRKVHSFCIGLEGSPDLHYAKKVAEFHGFE
HHSFTYTVDEGLDYIPEVIYHTETFNNTTIRASTPMYMMCRRIKALGIKICLTGEGSDEL
FGGYLYFHKAPNRVEFHQELIRKLHDLHKYDLLRANKACLAWGIETRPPFMNKQWIEYVM
QIDPKYKMINAFEPQMEKYILRKAFEDLEHPFVPQEILWRQKEQFSDGVGYSWRDGIMKR
ANYLISDSEFSQASIKYPISTPRNKEQYWFRQIYSSYFPSESAVLTVPFARSIACSTEKA
LEWDEAFKKNTDESGRAVLAVHNDAIKEITQLDDDRSTEDISKVQEHFQL
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggattttggcaattttaaatgtaaaaggaacagaagtttaagtaagagcaaaa
gcttatgagctatcaagaagaataagacatagaggtccggatagatcaaagataattgaa
atcagccctgggctgtatcatgtgatttcccacgaaaggttgggattagtagatctaagt
gataaagggagacagccttttaggatggtggatgatgagaatataatctttatgcagaat
ggggagctatacgattactgggatgtaagacctgagttggagaagaaatatcgatttagc
agtaattctgacactgagatagtaggaatgttatacaaagagtacggtgcaggaaacttt
tggaatcacttgaatggaatgtttgcaactgttctaattgatatgagtaagaaatcattt
taagcggggagagatcatattgggatagttccattatattacggatttaatgaagatgga
tctctatttttatcctctgagttgaaaggaatccatgattaggtgatagaagtcaaatag
ttccctccaggttatatatatatatataatatttagacatatgagattaagagatggtat
aatccaatttggaataactttgatcatataccaacaggagagatcgatttttaagtgttg
agagataagtttgtggaagtggttcgaagagaaattcaaggcgatgctccatttggattg
tttatttctggaggtgttgattcttcaatagtggctggaattgtggctaaattaataaag
agaggggaaatagatttgagtaagagaggaatgaggaaagttcattcattttgcattgga
ttggaaggatctccagatttgcattatgctaagaaggtggcagagttccatggatttgaa
catcactcattcacctacacagtagatgaaggattggattacatccctgaagttatatat
catacagagactttcaataatacaaccattagagcatcaacacctatgtatatgatgtgt
agaagaatcaaagctttgggaatcaaaatatgtttaacaggcgaaggaagtgatgagtta
tttggtggatatttgtatttccacaaagcacccaacagagtagaatttcattaagaatta
atcagaaaacttcatgatttacacaaatatgatcttctcagagccaacaaagcttgtttg
gcatggggtattgaaactaggcctccatttatgaacaaataatggatagagtatgttatg
caaattgatcctaaatataagatgattaatgccttcgaacctcaaatggaaaaatacatt
cttagaaaggcatttgaggatttagaacacccatttgtgccataggaaatattatggaga
taaaaggaatagtttagtgacggagttggttatagttggagagatggtattatgaaacga
gccaattatttaatttcggattcagaattctcttaagcatctatcaagtatccaatatca
actcccagaaacaaagagtaatattggtttagatagatttattcatcctatttccctagt
gaaagtgctgttttaactgttccatttgcccgatccattgcttgttcaaccgaaaaagct
ttagaatgggatgaagcattcaaaaagaatacagatgaatcaggaagagcagtattagca
gttcacaatgatgcaatcaaggaaatcacctaattagatgatgaccgttcaactgaggat
atttccaaagtacaggagcatttctaattatga

DBGET integrated database retrieval system