KEGG   Paramecium tetraurelia: GSPATT00008694001Help
Entry
GSPATT00008694001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ptm  Paramecium tetraurelia
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    GSPATT00008694001
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    GSPATT00008694001
   00603 Glycosphingolipid biosynthesis - globo series
    GSPATT00008694001
   00604 Glycosphingolipid biosynthesis - ganglio series
    GSPATT00008694001
   00511 Other glycan degradation
    GSPATT00008694001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     GSPATT00008694001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 541 aa AA seqDB search
MIFVQLFFLAVNAIMPMPNSIIQGYQTARISSICQVKFFSNQEFPDHVIQLLLHYHELIT
QDEDCEFEESIQNTNIKIEGALKFEISIENYEQLYWVTSTKEEAYELQIDENLNVKIQAK
NHWGLARALDTVNQLAINNEIQNLPIQISDEPQYVHRGIMIDTARNYLPVKLIKRTIDAL
VINKLNVLHWHITDDESFPLLLSKYSQITNNSKFWKDGFFTKKDVQEIIEYASIRAVQII
PEIDTPAHVHSWGISPDLQSIVITCDTNIRQYGQLDPTLDQTYEVLTSILQDLNDMFDKV
QFIHFGGDEASNQCFEQKPSIKEFMNQHGISNYFDLQVYYRKKQKDIWKNQIKSKKKIIY
WYNKNDQLPADQDDIIQWWGLSSQLSEVKGRSNQFILSDYHPLYLDTGVGNAFGDRYDRY
QAWKDVYKWRPSIPRNFEGTILGGESLLWGETNNQNTHFQKLFLRSSILADTLWNPDQKQ
DELFPKFTKRLSDMEDRMNKYGFPVSPFTHSYCKRQLDLCFPELYSTKLKLFFMFVLFYS
I
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgatttttgtttaattgttttttttagccgtgaatgccataatgccaatgcctaactca
ataatataaggttattaaacagccagaatttctagcatatgctaagtcaaatttttttca
aattaagaatttccagatcatgtaatataactattacttcattatcatgaattaataacc
taagatgaagattgtgaatttgaggaatctatttagaatactaatataaaaattgaagga
gctctaaagtttgagattagtatagaaaattatgagcaattatattgggttacaagtaca
aaagaagaagcttatgaattacaaatagatgaaaacttaaatgtgaagatataggcaaag
aatcattggggtttagctagagctcttgataccgtaaatcaattagcaataaataatgaa
atttagaatttaccaatctaaataagtgatgaaccatagtatgttcatagaggaataatg
atagacacagccagaaactatttacctgtaaaattaattaagagaactattgatgctttg
gtaattaataaattaaatgtattgcattggcatattaccgatgatgaaagctttccatta
cttctaagtaaatatagttaaataactaataattctaaattttggaaggatgggtttttt
acaaaaaaagatgtataagaaattatagaatatgcatcaattagagcagtttaaatcata
cctgaaatagatacaccagcacatgtacattcttggggaatatctccagatttataatca
attgtgattacatgtgatactaatatcagataatatggttaattagatccaactttagat
taaacatatgaagtcttaacttctatcttataagatttaaatgatatgtttgataaagta
taattcattcattttggtggtgatgaagctagtaattaatgttttgaataaaaaccatca
attaaagaattcatgaatcaacatggaatttccaattattttgatctttaagtttattat
agaaaaaaataaaaagatatttggaaaaattaaattaaatctaaaaagaaaattatttat
tggtataacaaaaatgattagcttcctgcagattaagatgacattatttaatggtggggt
ctttcctcttagcttagcgaagtaaaaggtaggtctaattaattcatactaagcgattat
catcccttatatttggacactggagttggaaatgcttttggggatagatatgatagatat
caagcctggaaagatgtttataaatggagaccaagtattccacgtaattttgaaggaact
atattggggggtgaaagtctactttggggtgaaactaataattaaaatactcacttttaa
aaattatttttaagatcttcaattttagctgacactctatggaacccagactaaaagcaa
gatgaattgtttccaaaattcacaaagagattgagcgacatggaagatagaatgaacaag
tatggttttcctgtctctccttttactcatagttattgtaaaagacagctagatttatgt
tttccagagctttattcaacaaaattaaaattgttcttcatgtttgttttattttattca
atatga

DBGET integrated database retrieval system