KEGG   Paramecium tetraurelia: GSPATT00008820001Help
Entry
GSPATT00008820001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K09584  protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    GSPATT00008820001
Enzymes [BR:ptm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     GSPATT00008820001
Chaperones and folding catalysts [BR:ptm03110]
 Protein folding catalysts
  Protein disulfide isomerase
   GSPATT00008820001
Membrane trafficking [BR:ptm04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    GSPATT00008820001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 OST3_OST6 Thioredoxin_7 Thioredoxin_8 AhpC-TSA Thioredoxin_9 DDE_Tnp_1_2 Serglycin
Motif
Other DBs
NCBI-GeneID: 5025560
NCBI-ProteinID: XP_001439775
Genoscope: GSPATT00008820001
UniProt: A0CNL1
Position
undetermined
AA seq 425 aa AA seqDB search
MNKVICLLSLLLATSYALYDSRSKVQLLTPQTFREKVLNSKSLWIVEFFAPWCGHCKALA
PEYEKAAKALEGIVNIAAVDADAHKDLGGQYGIQGFPTIKFFGENKSSPSDYQGERSAQG
IINFALEQVKSTVNSRQKGSSSNRNQQKQSSGSGSGSGSGSADDVIVLTDSTFDENVLKS
KDSWFVEFYAPWCGHCKKLEPEWNKVGSDLKGKVKVAKVDATANTQLATRFGVSGYPTLK
FFPAGFSNDSEVISYDGARDSSAMIEFALEQSNKSKKVEVLELLSKDILKENCLDYNGVC
IIAFLPHIYDSNKQERNQYINQLLEVAKSLKNKPVNFLWTQGGDNYEFEEAFQSAAAHPS
VMALSGRKSVYAKLKGAFSKQNIEQFVNNVLNGREHFNQYSQLPHFKKVDKWDGQDHKPV
YNDEF
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagttatctgtcttctatcactattgttggctacttcttatgcactctatgat
tcacgatccaaagtgtagctccttacaccttaaacattcagggagaaagtcttaaactct
aaatcactttggatagttgaattctttgctccatggtgtggccattgcaaagcactagcc
cccgaatatgaaaaggcagcaaaggctctagaaggaatagtgaatattgctgcggttgat
gcagatgctcacaaggaccttggaggacagtatggtatttaaggattccctacaatcaaa
ttttttggagaaaacaaaagttctccttctgattaccaaggagaaagatcagcctaagga
ataatcaactttgcattagaataagtgaaatcgactgtgaatagtagataaaaaggatca
tcgtcaaatagaaattaataaaaacaatcgtctggatctggatctggatcaggatctgga
tcagctgatgatgttattgttcttaccgattcaacatttgatgaaaatgttcttaaatct
aaggattcttggttcgttgaattctatgcaccttggtgtgggcactgtaagaaactagaa
cctgaatggaataaagtaggatcagatcttaagggaaaagtcaaagtggctaaggtagat
gccactgcaaatacttaattagcaactcgttttggagtctcaggatatccaactttgaaa
ttcttccctgcaggtttctccaatgactcagaagttatctcttatgatggtgctagagat
tcctctgcaatgatagagtttgctttagaataatctaataagtcaaagaaggttgaagta
ttggaactattatcaaaagatatcttaaaagaaaattgccttgattacaatggtgtctgt
ataattgcatttctacctcatatctacgatagtaataaataagaaagaaattaatatatc
aattaattgttagaagttgctaaatcactgaaaaataagccagtgaatttcttatggact
taaggaggagataactatgaatttgaagaagcattctaaagtgctgctgcacatccttca
gtaatggcgttaagtggcagaaaatctgtttatgctaaacttaaaggagcattcagtaaa
taaaatattgaataatttgtgaataatgtattaaacggaagagagcactttaattagtat
tcttaacttcctcattttaaaaaagttgacaaatgggatggataggaccataaaccagtt
tataatgatgaattctga

DBGET integrated database retrieval system