KEGG   Paramecium tetraurelia: GSPATT00008926001Help
Entry
GSPATT00008926001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K11252  histone H2B
Organism
ptm  Paramecium tetraurelia
Brite
Chromosome and associated proteins [BR:ptm03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    GSPATT00008926001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GSPATT00008926001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like DUF1639
Motif
Other DBs
NCBI-GeneID: 5025717
NCBI-ProteinID: XP_001439932
Genoscope: GSPATT00008926001
UniProt: A0CP18
Position
undetermined
AA seq 124 aa AA seqDB search
MGPTKSPKAEAKKTVKTVKTKKPTDEKKKARRRQETFALYIYKVLRQVHPEIGVSRKAMN
IMNSFINDIFDRIALEASKLVRFNKRRTLSSREIQTAVKLLLPGELARHAISEGTKAVTK
YTSG
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atgggcccaacaaaatcaccaaaagctgaagcaaaaaaaacagttaagacagttaaaact
aaaaaacccacagatgaaaagaagaaggcaagaagaagataagaaacatttgctttatat
atctacaaagtcttgagataagttcacccagaaattggtgtttctagaaaggccatgaac
atcatgaattcattcatcaatgatattttcgacagaattgctcttgaagccagcaaatta
gtcagatttaacaagagaagaactcttagttcaagggaaatctaaactgctgtcaaattg
ttactcccaggagaattggccagacatgccatctcagaaggaaccaaagcagtcaccaaa
tatacaagtggatga

DBGET integrated database retrieval system