KEGG   Paramecium tetraurelia: GSPATT00008973001Help
Entry
GSPATT00008973001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ptm  Paramecium tetraurelia
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    GSPATT00008973001
  Lipid metabolism
   00062 Fatty acid elongation
    GSPATT00008973001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     GSPATT00008973001
Lipid biosynthesis proteins [BR:ptm01004]
 Fatty acid synthase
  Component type
   GSPATT00008973001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 281 aa AA seqDB search
MFLLIPLYFFLGQTLPTVLFHGLGDSCSWSMLKSFFSDINADCIEIGSGPSSSILLGFLD
QAKDACVKVQEKYAGQTINVVGLSQGALIGRYIITDCDLKGGRVSKYLSIGGPQMGVSVI
PHCNSYLCWPLNKVVDSLVYTDYVQQHIGPAGYFRNHEDLDSYLKYNHFLPDLNNERNPE
CSRKSKVQLNISVQFSSLDQVMLVKFLQDEMVLPKESAFFESVDPETDKVVPLVESEFYI
QDYIGVKQLDQQRKIKFIEIDDSHLKWTDDITKNVFIPFLV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtttttattaattccactttatttttttttaggataaactctgccaacagtacttttt
catgggttaggtgatagttgctcttggtccatgcttaaatcttttttttcagacatcaac
gctgactgtatagaaataggttcaggaccatcatcctcgatcttgttgggatttttagat
taagccaaggatgcttgtgtcaaagtataggaaaaatacgcaggttaaacaataaatgtt
gttggtctatcacaaggtgcattgattgggagatatattattacagattgtgacttaaaa
ggaggaagagtgtctaagtatttatctataggaggtccttaaatgggagtatcagtcata
cctcattgcaatagttatttgtgctggccattaaataaagtagtcgattctctagtttac
actgattatgtgtaataacacattggtccagcaggttatttcagaaatcacgaagactta
gattcttatttaaaatacaatcattttcttccagatttgaataatgaaagaaatccagaa
tgttcaaggaaatcaaaagtataacttaatatatcggtttagttttcatcgcttgaccaa
gtgatgcttgtgaaatttttacaagatgaaatggtgctaccaaaagaatctgcatttttt
gaatctgtagatcctgaaacagataaagtggttccacttgtagaatcagaattttatatc
taagactatattggtgtaaagtaactggattaacaaaggaaaataaaatttattgagatt
gatgattctcatttaaaatggacagatgatataacaaagaatgtatttattcctttctta
gtttga

DBGET integrated database retrieval system