KEGG   Paramecium tetraurelia: GSPATT00008973001Help
Entry
GSPATT00008973001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
ptm  Paramecium tetraurelia
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ptm01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:ptm00062]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 281 aa AA seqDB search
MFLLIPLYFFLGQTLPTVLFHGLGDSCSWSMLKSFFSDINADCIEIGSGPSSSILLGFLD
QAKDACVKVQEKYAGQTINVVGLSQGALIGRYIITDCDLKGGRVSKYLSIGGPQMGVSVI
PHCNSYLCWPLNKVVDSLVYTDYVQQHIGPAGYFRNHEDLDSYLKYNHFLPDLNNERNPE
CSRKSKVQLNISVQFSSLDQVMLVKFLQDEMVLPKESAFFESVDPETDKVVPLVESEFYI
QDYIGVKQLDQQRKIKFIEIDDSHLKWTDDITKNVFIPFLV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgtttttattaattccactttatttttttttaggataaactctgccaacagtacttttt
catgggttaggtgatagttgctcttggtccatgcttaaatcttttttttcagacatcaac
gctgactgtatagaaataggttcaggaccatcatcctcgatcttgttgggatttttagat
taagccaaggatgcttgtgtcaaagtataggaaaaatacgcaggttaaacaataaatgtt
gttggtctatcacaaggtgcattgattgggagatatattattacagattgtgacttaaaa
ggaggaagagtgtctaagtatttatctataggaggtccttaaatgggagtatcagtcata
cctcattgcaatagttatttgtgctggccattaaataaagtagtcgattctctagtttac
actgattatgtgtaataacacattggtccagcaggttatttcagaaatcacgaagactta
gattcttatttaaaatacaatcattttcttccagatttgaataatgaaagaaatccagaa
tgttcaaggaaatcaaaagtataacttaatatatcggtttagttttcatcgcttgaccaa
gtgatgcttgtgaaatttttacaagatgaaatggtgctaccaaaagaatctgcatttttt
gaatctgtagatcctgaaacagataaagtggttccacttgtagaatcagaattttatatc
taagactatattggtgtaaagtaactggattaacaaaggaaaataaaatttattgagatt
gatgattctcatttaaaatggacagatgatataacaaagaatgtatttattcctttctta
gtttga

DBGET integrated database retrieval system