KEGG   Paramecium tetraurelia: GSPATT00009455001Help
Entry
GSPATT00009455001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
ptm  Paramecium tetraurelia
Pathway
Basal transcription factors
Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    GSPATT00009455001
  Replication and repair
   03420 Nucleotide excision repair
    GSPATT00009455001
Transcription machinery [BR:ptm03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     GSPATT00009455001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 400 aa AA seqDB search
MSQQLEDFLGCLQLLDTSIYKPQEQACIPVFRSLPPNLRTIIQRMVFFEERKVPESIIQA
QNYQQSPNTILDLAIQLKLITKQEERQQQAVNSYYYLDSNFQNSLRDSIEGKSKSILTKI
GDCTENKELLKRECSRKWKDLFDLISRRDRSDLSCYRQQVRQTLIESKLLERNLGVGFSF
ILSSTHKQINQILKYYVTKQSSNVVRFILCLSVLDPMKIYQMPNEEWQKNVIKDLQEFGL
THYQDQQMRITFLFWNFLYEPPSVSIGIQCNIIVEANFRIYAYLNSGDQQEEEILCNLLN
LFSEIKKRFKILIIADLSESSIRKAVRENLQAKQIIQFLEMNSKQLKQQAATEKQHKSND
ELKKRLDFLRVFQEGVPEKAIIPHNVVQQIQYWESFSNIK
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcttaataattggaagatttcttaggatgtttgcaactattagatactagcatctat
aaaccttaagaataggcatgtattccagtttttagatccttgccgccaaacttaaggaca
atcatttaaagaatggtattttttgaagaaagaaaagtccccgaaagtatcatacaagct
caaaattactaataatctcctaatacaattctagatctagcaattcaattaaaactaatt
actaaataagaagaaagataacaataagctgtaaattcttattactatttggattctaat
ttttaaaactcattgagagattctatagaaggaaaaagcaaaagcatactaacaaagatt
ggggattgtactgaaaacaaagaattattaaaacgagaatgtagtagaaagtggaaggat
ttatttgatctgattagtagaagagatcgctcagatctttcttgttatagataataagtg
agataaaccttaatagaatccaaattacttgaaagaaatttaggagttggattctctttc
attttgagttcaacacataaataaattaattaaattctcaaatattatgttactaaatag
tctagcaatgtcgtaaggtttatactttgtttgagtgttttggatccaatgaagatttat
caaatgccaaatgaagaatggcagaaaaatgttatcaaagatttataagaatttggttta
acacattatcaggattagtaaatgagaattactttcctattttggaactttctttatgaa
ccccccagtgtttcaataggaatttaatgcaacatcattgttgaagctaatttcagaatt
tatgcgtacttaaactctggtgatcaataggaagaggagatcttatgcaatctattaaat
ttgttttcagaaatcaaaaaacgatttaaaatcttaataattgctgatctatctgaatcc
agcatcagaaaagcagttagggagaatttataagcaaaacaaattatttaattcttagaa
atgaatagcaaataattgaagtaataagctgcgactgaaaaataacataagagcaatgat
gaattaaaaaagagattagattttcttagagtgttttaagagggagtaccagaaaaagct
atcataccacataatgttgtgcaacaaatctaatattgggaaagtttttcgaatattaaa
tga

DBGET integrated database retrieval system