KEGG   Paramecium tetraurelia: GSPATT00009496001Help
Entry
GSPATT00009496001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ptm  Paramecium tetraurelia
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GSPATT00009496001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     GSPATT00009496001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 264 aa AA seqDB search
MDQQQFDSELQTYFLHIKHEIKQEHIEYLKKHPELNQILNDFTSQIILEKPDNVYQYAKE
YFSFFNQEKDLKTCKPLVISGASGVGKGTLLQMLFKQYPQQFVFSVSYTTRAPRPGEVHG
QHYYFVSKEEFQKEIEKKAFLEYSEVHGNYYGTHLAQVQKVMKQGQVCVIEIDVQGAEKI
SKSMPNQCNYIFINAPSVEELRKRLTGRGTETEEVIEKRMKNAQKEIEKAHQLGFYNELL
NDDLQKTFKKLIDLLKTFYVDLKL
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggattaataacaatttgactctgaactgcagacatactttctacacattaaacatgaa
atcaaataggaacacatagaatatttgaaaaagcacccagagttaaattagatattaaat
gatttcacaagttagattattttggagaaacctgataatgtttatcaatatgctaaagaa
tacttcagtttctttaatcaagaaaaagatcttaagacttgcaagcctttagttatttca
ggggccagtggagttggaaaaggaactttattatagatgctttttaaacaatatccacaa
taatttgtatttagtgtgagctacacaacaagagcaccaaggcctggtgaagttcatgga
taacactattattttgttagcaaagaggagttctagaaagaaattgaaaagaaggcattt
ttagaatatagtgaagtgcacggaaattattatgggactcatttggctcaagtgcaaaaa
gtgatgaagtaaggataagtctgtgtgattgaaatagatgtttaaggtgctgaaaaaatt
agcaaatctatgccaaatcagtgtaattatattttcattaatgcaccatctgttgaggaa
ttgagaaagagactaactggaagaggaacagagacagaggaagtcattgagaaaagaatg
aaaaatgcacaaaaagagatagagaaagcacattaattaggattctataatgaactatta
aacgatgatctgcaaaaaacctttaagaaacttattgatcttctcaaaaccttttatgtt
gatctaaaattatga

DBGET integrated database retrieval system