KEGG   Paramecium tetraurelia: GSPATT00010191001Help
Entry
GSPATT00010191001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     GSPATT00010191001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_23 Methyltransf_32 EF-hand_1 PrmA Methyltransf_25 EF-hand_5 MTS Methyltransf_11 Methyltransf_18 EF-hand_6 CMAS
Motif
Other DBs
NCBI-GeneID: 5027140
NCBI-ProteinID: XP_001441355
Genoscope: GSPATT00010191001
UniProt: A0CT41
Position
undetermined
AA seq 231 aa AA seqDB search
MNNKLEKLVQNLFKKGVIKSEIVKKVLLSVDRQQFVDESDKIYAYEDYPLQIGYNATISA
PHMHAYSLELLKDHLQNGVRALDIGSGSGYLCAAMFLMMKSQQSKVIGVEHVPELVEKSI
KNLSQQFKIIIDRAYNQQLKDKQIQIIRGDGRLGFEQEGPYQAIHVGAAAETIPQQLLEQ
LDKGGRMVIPVGKGNQVFQVIDKDQNGKINIQNVLGVRYVPLTDLNKQLNK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaactagaaaaattagtgcaaaatttgtttaaaaaaggtgttattaaatct
gaaattgttaaaaaagttttattatctgtggatcgttaataatttgttgatgagtctgat
aagatttatgcttatgaagattacccattataaataggctataatgcaacaatatctgct
cctcatatgcatgcttattctttagaattacttaaagatcatttataaaatggagtaaga
gctcttgatattggatctggaagtggatatttatgtgctgcaatgtttttaatgatgaaa
tcataataatcaaaagtaattggggtagaacatgttccagaattggttgaaaagtcaatc
aaaaatttaagctagtaatttaaaataataatagatagggcttataatcaatagttaaaa
gataagcaaatataaattataagaggagatggacgattagggtttgagtaagaaggcccc
tattaagctattcatgtaggggctgcagctgaaacaataccacagtaactattagaataa
ttggataaaggcggtcgtatggtaattcctgttggtaagggaaaccaagtgttttaagta
attgataaggatcaaaatgggaaaattaatatttaaaatgttctaggagtgagatatgtt
cctttgactgatttaaataagcaactaaataaatga

DBGET integrated database retrieval system