KEGG   Paramecium tetraurelia: GSPATT00010191001Help
Entry
GSPATT00010191001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ptm  Paramecium tetraurelia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 231 aa AA seqDB search
MNNKLEKLVQNLFKKGVIKSEIVKKVLLSVDRQQFVDESDKIYAYEDYPLQIGYNATISA
PHMHAYSLELLKDHLQNGVRALDIGSGSGYLCAAMFLMMKSQQSKVIGVEHVPELVEKSI
KNLSQQFKIIIDRAYNQQLKDKQIQIIRGDGRLGFEQEGPYQAIHVGAAAETIPQQLLEQ
LDKGGRMVIPVGKGNQVFQVIDKDQNGKINIQNVLGVRYVPLTDLNKQLNK
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgaataataaactagaaaaattagtgcaaaatttgtttaaaaaaggtgttattaaatct
gaaattgttaaaaaagttttattatctgtggatcgttaataatttgttgatgagtctgat
aagatttatgcttatgaagattacccattataaataggctataatgcaacaatatctgct
cctcatatgcatgcttattctttagaattacttaaagatcatttataaaatggagtaaga
gctcttgatattggatctggaagtggatatttatgtgctgcaatgtttttaatgatgaaa
tcataataatcaaaagtaattggggtagaacatgttccagaattggttgaaaagtcaatc
aaaaatttaagctagtaatttaaaataataatagatagggcttataatcaatagttaaaa
gataagcaaatataaattataagaggagatggacgattagggtttgagtaagaaggcccc
tattaagctattcatgtaggggctgcagctgaaacaataccacagtaactattagaataa
ttggataaaggcggtcgtatggtaattcctgttggtaagggaaaccaagtgttttaagta
attgataaggatcaaaatgggaaaattaatatttaaaatgttctaggagtgagatatgtt
cctttgactgatttaaataagcaactaaataaatga

DBGET integrated database retrieval system