KEGG   Paramecium tetraurelia: GSPATT00010579001Help
Entry
GSPATT00010579001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ptm  Paramecium tetraurelia
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ptm00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 324 aa AA seqDB search
MDKLHPLFAHPTQKLWNSCLPRKSQLVYPIFVVDGENQKQPINSMPNINRYSVDLLKEFL
EPLVIKGLKAVLIFGVIGNEDKDDVGSMAGGLGKDSCVHKALRVLKQAFPQLLLITDVCL
CAYTSHGHCGILTKDGYLDNQASIKRLSECALSYAQAGADIVAPSDMMDNRVRAIKELLD
QHPNLRVPIMSYSSKFCSALYGPFRDVCCSAPQKFDRSSYQLPPGARQLALQAAERDLKE
GAGYVMVKPITAYLDIAAEIKRRHPDTLLACYHVSGEYSMIHAGAEKKLFDLKRVVLEYM
EGFVRSGIDIIITYFTPELLDWLE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atggacaaattacatcctctattcgctcatccaacttaaaaattatggaatagctgttta
cctcgaaagagctaattagtttacccaatatttgtagttgatggagagaatcagaagcaa
ccaataaattcaatgcccaatattaatagatactctgtagatttattaaaagagtttctg
gaacctttggtgataaagggcttaaaggcagtgctgatttttggagtgataggaaatgaa
gacaaggatgatgttggatcaatggcaggaggtttgggaaaggattcttgtgttcacaag
gctttaagagtattgaaacaagcatttccctaattgttgttgataacagacgtttgcttg
tgtgcatacacatctcatggacattgcggaatattaacaaaagatggatacttggataat
caagccagtatcaaaaggttgagtgagtgcgctctttcttatgcacaggctggagctgac
atagtagctccatctgatatgatggacaatagagtgagagcaatcaaagaattgttagac
tagcatccaaatttgagagttccaattatgtcttattcatctaaattttgttcagcattg
tatggtccttttagagatgtgtgttgttcagccccttagaagttcgatagatcttcatat
taattaccaccaggggctcgacaattggcattgtaggcagctgagagagatttgaaggaa
ggggcaggttatgtgatggtcaaaccaataactgcctatttagacatagctgcagaaata
aagagaagacatccagatacattacttgcttgttatcatgttagtggggaatactcaatg
atacatgctggtgcggagaagaaattgttcgatttgaagagagtggtgttggaatacatg
gagggatttgttagaagtgggattgacatcatcatcacttatttcactcctgagttgttg
gattggttggaatga

DBGET integrated database retrieval system