KEGG   Paramecium tetraurelia: GSPATT00011231001Help
Entry
GSPATT00011231001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K03113  
translation initiation factor 1
Organism
ptm  Paramecium tetraurelia
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    GSPATT00011231001
Translation factors [BR:ptm03012]
 Eukaryotic Type
  Initiation factors
   eIF-1
    GSPATT00011231001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 107 aa AA seqDB search
MTDNQFDNQNEFDEMVNFNFVIHIHLKKRSARKTQTIIVGIPDEFDLNKIIRFWKKQFNC
TGGIISKDEDYGDQVTIRLTGDNRQQIAKFLVEEGIALQDNIKVHGI
NT seq 324 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaaccaatttgacaattagaatgaatttgatgaaatggtaaacttcaacttt
gtcattcatattcatttaaaaaagagaagcgctagaaaaacacaaacgattattgttggt
attccagatgaatttgatttaaataagattattagattttggaagaaacaatttaactgt
actggtggtattatttcaaaagatgaagactatggagattaagtcacaattagattgaca
ggagataatagatagtaaattgccaaatttttagtggaagaaggaatagcgttataagat
aacattaaagtccatggtatttga

DBGET integrated database retrieval system