KEGG   Paramecium tetraurelia: GSPATT00011309001Help
Entry
GSPATT00011309001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
ptm  Paramecium tetraurelia
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ptm04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 1701 aa AA seqDB search
MNPLRPIRVQEAYRFSQLGVSQTNFKFGQIFFESDKYITIRETAPNGDTQLLQFNFETKQ
LISQKNIIALRAAGEQPNSTVIQIFNLDEKQRIKNVELNETIVFWRWVNPQKLAYVTPTA
VYHINITNPNEQQVKVMDRYPLSSENPVQIIGYGLEGNEKWCALYGISTPDGGRTINGHI
QLFLIEQARQQILEGHCCCFGDALIHTDDYKSSLFCFVERKSGETTSRLHISEIGVPPNG
FQKYKRQVEVQTDPNYPTDFPVLMHINQRYGLIYVISKYSFLTVYELSTASLIFRERICN
ENVFVGAPNINQGQYHIIGKEGIVYTISVNDDQLVSYLINTCRHIPEVIQLGFRLASRYK
LPGADNMFVDQFNKAILSGDALSAAKIAASAPGTVLRNPESIAKFKQMQQQPGQPQPLIV
YFQTLLEKGTLNKFEAIELCGPILQQGRKQFVEQWIAQNKLEPSDELGDLLKKYDVNLAI
QIYKLSKSYQKLAQCYMETGQIELAMQLQQQFGVSTDYMAMLRNMMMQSPEQALAMAKSL
YQRDQSINVHQIAELFEQFQRLPEMTAFLVECMKNNRAEDGPLQTKVLCLNLQAAAQVAD
AILSMNIWTQFDRIRVAQLCEQKGLYQRALENYSDPKDVKRVILNTHALPPEFLINFLSR
VDPALTLQCLSDLLRHNRQNLQVVVNVAVQNNQRLTIPACIKVFESVSAFEGVYLFLGSL
INTTSDKDIYYKYIEAAAKCNQIKELERVITEKGDCYDADKVKNYLKEQKLSDPRPLIFL
CDMNGFVDELTRYLYKNGFTRYIEIYIFKVNPNAAPGVFGTLIDLECDEVYLKQLLYNIR
GMCPIEPTVDEFEKRNKLRVLEQWLEARVTEGNQIPAIHNALAKIKIDTSQDPDGFLINN
QFYDAKAVGKFCEERDPQLAVLAYKRAWGQCDQELINLTNKNEMYRVQAKYLVERQDVDL
WAGVLQETNPHRKNLIDYVIQALQDSKNVDEVQAAVKAFVLAKIPYELLGLLEKLVLHNP
EFMQYKQLQNLLIITAIQSDTSKVLDYINRLDKFDPQIIAQHCLNEEYNLFEEAYAVFKK
FNLHIDAVNVLLRNLGSIPRAHEYAQYASSPEVWSLLAEAYLNQGQTNESIDCYIKANDS
SAFLNIINVAEQEEKYELLVKYLLMCRQTVKDVNIDNSLIYCYAKLDKNLDIESLIQSSN
SADVIKVGERCYDQQLYEAAKILFTALKNNARIASCLVRLKQFNKAIEAAQKANTSKTWK
ELCFACVEASEFKYASIAAQNIIIVPDMLESLIKQYEEYNAQEEMMILLENALGMQRAHV
GIFTELAVLYCHYKQKKVMEHCRQYFQKMNILKVLRTCEKMCLWSEAVYLHQHYDQPDNA
INIMIEHSPTAFSHDVLVMLLQKITNTDLYYKCILFYLEEQPEQINDLLRSIQSKIDLSK
FVKLMKNTGYLALTLPFLQQIQNANNKDVNDALNQLYLDIEDYENLRESVKNYENFDQLA
LAQKTQSHELVEFRRIAAYLYRKIQKYDLSMNLSKQDQMYRDSVETAQESQNVKLVYELL
EFFIQNKESEFFTVCLYTCYDLLKPDQVMELTWRSGLMEFAMPYFIQITWELTHKIEYVQ
KKHEDREKKEIQTAQQQQSQALPIAQDFLLNQGQLMLGPPSQMNNSNISFGQPSGFTNSQ
MNQAPMGYGGQQFGSYQPPGF
NT seq 5106 nt NT seq  +upstreamnt  +downstreamnt
atgaatccattaagaccaataagagtttaagaggcataccgattttcttaattgggtgtt
agtcaaaccaatttcaagtttggttaaatattcttcgaatcagataaatatatcacaatc
agagagacagccccgaatggagatactcaattattgcaattcaattttgagacaaagcaa
ttgatttctcaaaagaatatcatcgctcttagagctgcaggtgaatagccaaattcaact
gtgatctaaatcttcaatttggatgagaaatagagaataaagaatgtcgaattgaatgag
actatagtgttttggagatgggtcaacccataaaaattagcatatgttactccaacagca
gtatatcacatcaatatcacaaatcctaatgagcaacaagttaaagtgatggacaggtat
ccattgtcatcagagaatccagtgtaaatcataggatatggattggaaggaaatgaaaaa
tggtgtgcattatatggtatttcaacaccagatggaggtagaacaattaatggtcacatt
caattatttttgattgaataggcaaggtaataaatcttagaaggacattgttgctgtttt
ggagatgccttgattcacacagatgactacaaaagcagtttattctgttttgtggagaga
aagtctggtgaaacaacaagcagattacatatctcagaaattggagtaccccccaatgga
ttctaaaaatacaaaagataagttgaagtttaaactgatccaaattatccaacagatttc
ccagtcttaatgcacattaatcaaagatatggattgatctatgtaataagcaaatattca
tttttgactgtctatgaattaagcactgccagtttgatattcagagagagaatctgcaac
gagaatgtctttgtaggtgccccaaacattaatcaaggataatatcatattattggtaag
gaaggtattgtctacacaatatctgtcaatgatgactaattggtgtcttacttaattaac
acttgcagacatattccagaggttattcaattgggattccgtttggccagtagatataag
cttcctggagcagataatatgtttgttgattaattcaataaggctatcttatctggagat
gctttgagtgctgctaaaattgctgccagtgctcctggaacagttcttagaaacccagaa
agtattgctaaattcaaataaatgcaacaacaaccaggataaccataaccactcatcgtc
tatttccaaacattattagaaaagggaacattaaataaatttgaagctattgaattgtgt
ggaccaattttataacaaggaagaaaacaattcgttgaataatggattgcataaaataaa
ttagaaccatcagatgaattaggagatctcttaaaaaaatatgatgtcaatttagctatt
caaatctataaattatccaaatcatattagaaattagcataatgctatatggaaactgga
tagatcgaattggctatgcaattataataacaatttggagtatcgacagattacatggct
atgttgagaaatatgatgatgtaatctccagaacaagccttggctatggccaaatcttta
tatcaaagagaccaaagcatcaatgttcatcaaattgctgaattatttgaataattctag
agattaccagaaatgacagcctttttggttgaatgcatgaaaaacaatagagcagaagat
ggaccactctaaactaaggtcttgtgcttgaacttataggctgctgcataagttgctgat
gccatcttatcaatgaacatttggacccaatttgatagaattagagttgcccaattatgt
gaataaaaaggactttatcaaagagcacttgaaaattattctgatcccaaggatgttaaa
agagttattcttaatactcatgctctccctcctgaattccttatcaatttcttatccaga
gttgaccctgcattgacattataatgcctttcagatttattaagacacaatagatagaat
ttataagttgttgtcaatgtcgcagtttaaaataattaaagattaacaatcccagcttgc
attaaggtctttgaatctgttagtgcatttgaaggagtctacctatttttgggatctttg
attaacacaacatctgataaggatatctattataaatatatcgaagctgctgctaaatgc
aattaaatcaaagaattagaaagagttattacagaaaaaggagattgttatgatgctgat
aaagtcaaaaattacttaaaggaataaaagttatctgatccaagaccattgatattctta
tgtgatatgaatggatttgttgatgaattgaccagatatctttataaaaatggattcact
agatatattgaaatctatatcttcaaagttaatcctaatgctgctcctggtgtatttggt
acattaattgatttggaatgcgatgaagtttacttgaaataattgttgtataacattcgt
ggaatgtgtccaattgagccaactgttgatgaattcgaaaaaagaaataaacttagagtc
ttggaataatggcttgaagctagagttacagaaggtaaccaaattccagctattcacaat
gcattagctaaaatcaagattgatacatcataagatcctgatggtttcttgatcaataat
caattctatgatgccaaggctgttggtaaattctgtgaggaaagagatccttaattagca
gttctagcttataagagagcttggggacaatgcgattaagaattaattaatttaacaaac
aaaaatgaaatgtacagagtctaagccaaatatctcgtagaaagataggatgttgattta
tgggctggagtattataagagacaaatccacacagaaaaaatttaattgactatgtcatt
taagcattataggactcaaagaatgttgatgaagtttaagcagctgtcaaagcatttgtg
ttggccaagattccttatgaattattgggtttgttagagaaattggttttacataaccct
gaatttatgtaatacaaataattatagaatttattaatcatcacagccattcaaagtgac
acaagcaaagtgttggattacatcaatagattggataaattcgatccatagattattgct
taacattgtttgaatgaagaatataacttgtttgaagaggcttatgctgtctttaagaaa
tttaatttacacattgatgctgttaatgtgttactcagaaatttgggcagcattccaaga
gctcatgaatatgcttagtatgctagttccccagaagtatggtcattattggctgaagct
tatttgaattaaggataaacaaatgaatccattgattgctacatcaaggctaatgattca
agtgcattcttgaatattattaatgttgctgaataagaagagaaatatgaattattagtc
aaatatctcttaatgtgcagataaacagtcaaggatgtcaacattgacaattcattaatc
tattgttatgccaaattagacaagaacttagatattgaatctttgatttaatcaagcaac
tcagcagatgtaattaaggtaggagagagatgctatgatcaataattatatgaagcagct
aagatcttattcactgcccttaaaaataatgcaagaatagcatcttgtttggttagatta
aaataatttaacaaagctattgaagcagcttaaaaggccaatacttccaagacatggaaa
gaattatgctttgcttgtgttgaggcatcagaattcaagtatgcttccattgctgcttag
aatattatcattgtaccagatatgttggagtcattgatcaaataatatgaagaatacaat
gcataagaggaaatgatgatattattggagaatgccttaggtatgtaaagagcacatgtt
ggtatcttcacagaattagcagttctttattgccattacaaatagaagaaagtcatggaa
cactgcagataatacttctaaaagatgaacattttgaaagtcttaagaacttgtgaaaag
atgtgtctctggagtgaagctgtctacttacatcaacactatgattaaccagataatgct
atcaacattatgatcgagcattcaccaactgccttctcacatgatgttctagttatgtta
ctctaaaagataaccaatacagatttgtattacaaatgtattctcttttaccttgaagaa
taaccagaataaattaatgatttattaagaagcattcaatctaagattgatttaagcaaa
tttgttaaattgatgaagaacactggctatttggctttgacattaccatttttataacaa
attcaaaatgccaataacaaagatgttaacgatgccttgaatcaactctatttagatatt
gaggactatgaaaatcttagagaatcagtcaagaactatgaaaactttgactaattggct
ttggcttaaaagacctaatctcacgaattggttgaattcagaagaatcgctgcttattta
tatagaaagatttagaaatatgatttatctatgaacctgagtaaataggactaaatgtac
agagattcagtcgaaacagcttaggaatcttagaatgttaagttagtttatgaattattg
gaattcttcatataaaacaaggaaagtgaattctttacagtgtgtctttacacatgctat
gatttattgaaaccagactaagttatggaattgacttggagatcaggccttatggaattt
gctatgccatacttcatctaaatcacttgggaattgactcacaaaattgagtatgtataa
aagaagcacgaagacagagaaaagaaggaaattcaaacagcacaataacaataatcataa
gctctaccaatagcttaagatttcttattgaactaaggctaattaatgttgggtccacca
agccaaatgaataacagcaatataagctttggatagccttccggtttcacaaattcctaa
atgaattaagctcctatgggttatggaggttaacaatttggatcatattagccacctggt
ttttga

DBGET integrated database retrieval system