KEGG   Paramecium tetraurelia: GSPATT00011474001Help
Entry
GSPATT00011474001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
ptm  Paramecium tetraurelia
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    GSPATT00011474001
  Metabolism of other amino acids
   00480 Glutathione metabolism
    GSPATT00011474001
Enzymes [BR:ptm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     GSPATT00011474001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 182 aa AA seqDB search
MGSIFFKKGVDKLQPPTKSFFDFELNNIDGQKTQLSQFKGKKAYICVNVACSCGLTSSNY
SELVELYKTYSAQGLEILGFPCNQFMGQESKPEPEIKEFVLSKYGVSFPLFQKIEVNGQN
THEIYRYLRLNSSLKTSANEAKEVPWNFGKFLLNSQGQVVRFFNPDQKPKEMKQDIEKLL
SQ
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgggatcaatattttttaaaaaaggagtagataaacttcaaccaccaacaaaatcattc
ttcgattttgaactcaataatattgatggatagaaaacttaactatcttaattcaaaggc
aaaaaagcttacatttgtgtgaatgttgcttgttcttgtggattaacatcttcaaactac
agcgaacttgtggaactttataaaacctatagtgctcaaggtttagaaatcttaggattt
ccatgtaatcaatttatgggttaggaatccaaacctgaacctgaaatcaaagagtttgtt
ctctctaagtatggtgtatccttcccattgttttaaaaaattgaggttaatggataaaac
actcatgaaatttatagatatttgagattgaacagttccttaaaaactagtgccaatgaa
gcaaaagaagtaccatggaattttggaaaattcttattgaattcatagggtcaagtcgtg
agattttttaatccagattagaaaccaaaagaaatgaagcaagatatcgaaaaattgttg
agtcaatga

DBGET integrated database retrieval system