KEGG   Paramecium tetraurelia: GSPATT00011804001Help
Entry
GSPATT00011804001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ptm  Paramecium tetraurelia
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ptm00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:ptm00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:ptm00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ptm00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 539 aa AA seqDB search
MNLFVLFLFCVIFHNVASLMPMPKAIQKGDQVVKIENKCSLRYQATEDQYPDFILELLEH
FHTLMTPKQCNFRQSFGFTNDLGAMKISMQIESFEQLYGVDTTKQESYRLDIDNELNVQI
QVNNHWGLVRALNTLNQLSEKGEIHDLPLTIEDEPTYSYRGILIDSARHFLSVQLIERTI
DSLVMNSMNTVHWHITDDESFPLLLTEYPGITHSTKYSENSYYTINDTTRIVEYASKRGV
QIIPSFDSPGHSMSWGMTKELADIMMMCGSTIKQYGVLDPTLEKTYQVLESILKDFYQMF
KKVKFVNFAGDEVSKTCWDQRPEIKEFMQKNNINDYFELQSYYRRRQKQLWKDVIKAEQD
IIYLYRKEDNLPLDKDDIIHWWGNTDQLPDVADKPNRIILMDYFPLFIDAGFGNAFGNPY
SVYHTWKEIYKWTPSLPQGSLNTIIGGEVPLWGETNNQNTHFNKLYMRTSVIAETLWNPK
VKETEKYASFVKRLIQMEDRMTKQGFPVTPVTHGYCRKNTELCFPVLSEEEQKEQIQTE
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaatttatttgtactttttctattctgcgtcatatttcataatgtcgctagcttgatg
cctatgcctaaagctatatagaagggagattaggttgtcaaaattgagaataaatgctca
ctacgatatcaagcaactgaggatcaatacccagatttcattttggaattacttgaacat
tttcatactttgatgactccaaagcaatgtaattttagataatcttttgggtttacaaat
gacttgggagccatgaagatctccatgcaaatagaatcctttgaataattgtatggagtt
gatacaactaaataagaatcatatagattagatattgataatgaattgaatgtttaaatc
caagtgaataatcattggggtttggtcagggctttgaacaccttaaattaattaagtgag
aaaggagagatacatgatcttcccttaacaatagaggacgaaccaacttatagttacaga
gggattttgattgatagtgctagacactttctatctgtccaattgatagagagaacaatt
gattccttagtcatgaattcaatgaacacagtccattggcatattacagatgacgagagt
tttccattactattaacagagtaccctggaattacacattcaacaaaatattcagagaat
tcatattatacaataaatgacactacaagaatagttgaatatgcttcaaaaagaggagtt
taaataatacctagttttgatagtcctggacattcaatgagttggggaatgactaaagaa
ttagctgatattatgatgatgtgtggaagcacaataaaataatatggtgtgcttgatcca
acattagagaagacttatcaagtcctagaatctatattaaaggacttctatcaaatgttc
aagaaggtcaagtttgttaactttgcaggtgatgaggtcagcaagacttgttgggatcaa
agacctgaaattaaagaattcatgtaaaaaaacaacattaatgattattttgaattgcaa
tcctattacagaagaaggtaaaagtaattatggaaggatgtcattaaagcagaacaagat
atcatctatctctatagaaaagaagacaatttaccacttgataaagacgatattattcat
tggtggggaaatactgatcaattaccagatgttgctgataaacctaatagaatcatattg
atggattatttcccattgtttattgatgcaggctttggaaatgcctttggaaatccttac
tctgtttatcatacatggaaagaaatctataaatggactccatcccttccataaggatca
ctgaatactatcataggaggtgaagttcctttgtggggagaaactaataatcaaaataca
catttcaataaattatacatgagaacatcagttattgcagaaactctttggaatccaaaa
gtcaaagaaactgaaaaatatgcttcttttgttaaacgtcttattcaaatggaagataga
atgacaaaatagggctttcctgttactcctgttactcatgggtattgtagaaaaaataca
gaactatgttttccagtcttaagtgaagaggaataaaaagagtaaatataaactgaatga

DBGET integrated database retrieval system