KEGG   Paramecium tetraurelia: GSPATT00011825001Help
Entry
GSPATT00011825001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
ptm  Paramecium tetraurelia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 323 aa AA seqDB search
MDQGTFKAPKVKLTDYEILQTLGTGSFGRVRLAKHKQNGEYVALKMLKKAEILRLKQVDH
IISENTILSNISHPFLIKMLGFTQDERYLYFLLEYVQGGELFTYLRNKGKLENEEAQFYA
SQVVLMFEYLHTKNIVYRDLKPENLLIGSDGYLKLTDFGFAKFIDSRTYTLCGTPEYLAP
EILLNKGHGKPVDWWCLGILIYEMLAGIDPFNDEDPMAIYQKILKGKVKFPRNFDKEAKS
LVKHLLVADLTKRYGNLKGGANDIKAHRWFQSLDWEFLLQKKIQPKYKPVVKNKGDTSNY
STYPDSTELPKPVKPTDDPFINW
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggattaaggcacctttaaggcaccaaaagttaaattaactgattatgagatcctttaa
actttaggaacagggtcctttggaagagtgaggttggcaaaacataaatagaatggtgaa
tatgtagctctgaaaatgttaaaaaaagccgaaatcttaaggcttaagtaagtcgatcac
atcatatcagagaatactattctttctaatataagccatccatttttaataaaaatgctt
ggatttactcaagacgagaggtatctctattttcttttagaatatgtttaaggaggggag
ttgtttacgtatctcagaaataagggtaaactggaaaatgaagaagcttaattttatgca
tctcaagtagttttgatgtttgaatatcttcataccaaaaatattgtttatagagatctt
aaacctgaaaatcttctcattggatcagatggttatctcaaattaactgattttggattt
gccaaatttattgattctagaacttatactctgtgtggaacaccagaatacttagctcct
gaaattctactcaataaaggacatggaaaaccagttgattggtggtgtctgggcatttta
atttatgaaatgttagccggaatagatccatttaatgatgaagatcctatggcaatatac
taaaaaatattaaagggaaaggtgaagtttccaagaaatttcgacaaggaagcaaaaagt
ctggtcaaacatttattggtagctgatttaacaaaaagatacggtaatcttaaaggagga
gcaaacgatataaaggctcacagatggttttaaagtctagattgggaatttttactttaa
aaaaaaatacaaccaaaatataaaccagttgtaaaaaataagggtgacacttcaaactat
tccacatatcctgatagtacagaattacctaaaccagtaaaaccaactgatgacccattt
attaattggtga

DBGET integrated database retrieval system