KEGG   Paramecium tetraurelia: GSPATT00012401001Help
Entry
GSPATT00012401001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ptm  Paramecium tetraurelia
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ptm00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 454 aa AA seqDB search
MSHKFVIVGAGLSGLSNAFFIKHFFPKAQITLVEQSNRVGGMIISNNRNGFICEEGPRSI
RMGKYNRPLYHILNKIGLYKEFVPSIQQPYSYIYWNGKLNAVPLQMNLETISQFVQDNGS
GDVFKLIKAYPKMLFKKLDTDNLGDYLELVLGRDLTEKYAESVFYGIYGESVYNLSKALC
YQKSHMKGYDEQQISKDLSFDKDFEQARDQKLKGANSYRFKEGVESLPKRMHAYLQETYE
SDYKVKLNSKAKCIDLSRKELVVESREEQEEQRLNYDYLILNAPTHQLSQIMINSNLNKV
GEMFRGVKCNTLVTRNICWDQKILPKEFKGFGYLINPKQQQVILGMVADSLSFPSQYPEN
ATNLSVMSIYDVNDHVILSELSKHLGVKIPDPKEIVTKSWSKAFTQFSPGHQEEMKKIES
ELNAKSIIIGANNYTLAIPELVYLSYSKVKQLYL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacaaatttgtaattgttggtgctggtctttctggattgagcaatgcatttttc
attaagcattttttcccaaaggcttaaataactttagtagagtaatctaatcgtgtcggt
gggatgatcatttcaaataatagaaatggatttatttgtgaggaaggtccaagatcaata
agaatgggaaagtacaatagaccactatatcatattctaaataagatcggactttataaa
gaatttgtgcccagtattcagtagccatatagttatatatattggaatgggaaattaaat
gctgttcctctgcaaatgaatttagaaacaatatcctaatttgtataggataatggaagt
ggggatgtctttaaactaataaaagcatatccgaagatgttgtttaagaaactagatacg
gacaatttgggagattacttggagttggtattgggaagggatttgactgaaaaatatgct
gagtccgtattttacgggatctatggggaatcagtgtataatttatcgaaggctttgtgt
tactagaagagtcatatgaaaggatatgatgaatagcaaataagcaaggatttgagtttc
gataaggactttgaataggcgagggattagaaattgaaaggagcaaatagttatagattc
aaagaaggtgtagagtctctaccaaagaggatgcatgcttatttataagagacatatgaa
tcggattataaggtgaagttgaattcgaaggctaagtgtattgatctgtcaagaaaggaa
ttggtagttgagagtagggaggaataggaggagtaaagattaaattatgattatttgata
ttgaatgctcctactcatcagttatctcagataatgattaattctaatttgaataaggtt
ggggagatgttcagaggagttaagtgcaatacattggtgactagaaatatatgttgggat
caaaagatattgcctaaggaatttaaaggcttcggatatttaataaatccaaagtagtag
taggtgattttggggatggtggcagattcactttcctttccttcgtaatatcctgagaat
gctaccaatttatctgttatgtcaatatatgatgtgaatgatcatgtgattttgagtgag
ttgagtaaacatttgggagtgaagattcctgatccaaaagagatagtcactaaaagttgg
tcaaaagcatttactcaattttcacctggacattaggaggaaatgaagaagatagagtca
gaattgaatgcaaaaagtataataataggagccaacaattacacactggctatcccagaa
ttggtgtacttgtcctatagtaaggtgaaacaattatatttgtga

DBGET integrated database retrieval system