KEGG   Paramecium tetraurelia: GSPATT00012401001Help
Entry
GSPATT00012401001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ptm  Paramecium tetraurelia
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GSPATT00012401001
Enzymes [BR:ptm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     GSPATT00012401001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 454 aa AA seqDB search
MSHKFVIVGAGLSGLSNAFFIKHFFPKAQITLVEQSNRVGGMIISNNRNGFICEEGPRSI
RMGKYNRPLYHILNKIGLYKEFVPSIQQPYSYIYWNGKLNAVPLQMNLETISQFVQDNGS
GDVFKLIKAYPKMLFKKLDTDNLGDYLELVLGRDLTEKYAESVFYGIYGESVYNLSKALC
YQKSHMKGYDEQQISKDLSFDKDFEQARDQKLKGANSYRFKEGVESLPKRMHAYLQETYE
SDYKVKLNSKAKCIDLSRKELVVESREEQEEQRLNYDYLILNAPTHQLSQIMINSNLNKV
GEMFRGVKCNTLVTRNICWDQKILPKEFKGFGYLINPKQQQVILGMVADSLSFPSQYPEN
ATNLSVMSIYDVNDHVILSELSKHLGVKIPDPKEIVTKSWSKAFTQFSPGHQEEMKKIES
ELNAKSIIIGANNYTLAIPELVYLSYSKVKQLYL
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacaaatttgtaattgttggtgctggtctttctggattgagcaatgcatttttc
attaagcattttttcccaaaggcttaaataactttagtagagtaatctaatcgtgtcggt
gggatgatcatttcaaataatagaaatggatttatttgtgaggaaggtccaagatcaata
agaatgggaaagtacaatagaccactatatcatattctaaataagatcggactttataaa
gaatttgtgcccagtattcagtagccatatagttatatatattggaatgggaaattaaat
gctgttcctctgcaaatgaatttagaaacaatatcctaatttgtataggataatggaagt
ggggatgtctttaaactaataaaagcatatccgaagatgttgtttaagaaactagatacg
gacaatttgggagattacttggagttggtattgggaagggatttgactgaaaaatatgct
gagtccgtattttacgggatctatggggaatcagtgtataatttatcgaaggctttgtgt
tactagaagagtcatatgaaaggatatgatgaatagcaaataagcaaggatttgagtttc
gataaggactttgaataggcgagggattagaaattgaaaggagcaaatagttatagattc
aaagaaggtgtagagtctctaccaaagaggatgcatgcttatttataagagacatatgaa
tcggattataaggtgaagttgaattcgaaggctaagtgtattgatctgtcaagaaaggaa
ttggtagttgagagtagggaggaataggaggagtaaagattaaattatgattatttgata
ttgaatgctcctactcatcagttatctcagataatgattaattctaatttgaataaggtt
ggggagatgttcagaggagttaagtgcaatacattggtgactagaaatatatgttgggat
caaaagatattgcctaaggaatttaaaggcttcggatatttaataaatccaaagtagtag
taggtgattttggggatggtggcagattcactttcctttccttcgtaatatcctgagaat
gctaccaatttatctgttatgtcaatatatgatgtgaatgatcatgtgattttgagtgag
ttgagtaaacatttgggagtgaagattcctgatccaaaagagatagtcactaaaagttgg
tcaaaagcatttactcaattttcacctggacattaggaggaaatgaagaagatagagtca
gaattgaatgcaaaaagtataataataggagccaacaattacacactggctatcccagaa
ttggtgtacttgtcctatagtaaggtgaaacaattatatttgtga

DBGET integrated database retrieval system