KEGG   Paramecium tetraurelia: GSPATT00012871001Help
Entry
GSPATT00012871001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
ptm  Paramecium tetraurelia
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ptm00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 298 aa AA seqDB search
MSDDPRFKIVEGIDGDYVIIGFPHHIGAKRDNVRIGQDHGPDSLRRFLPRIGPLRNAEYM
KDISNFIVSDYGNIHVDDDQNLEKLLEKLNQKVKIVHNKNHIPIVIGGSKDCVFGVLSDD
LHVISINHIPDIQVPYDGNKPSINSGLRASTSKISITYFGYDNSKLNQEQENYINEKCNG
ISLQKIRQAQKAFHQDLEQQVTQAGILFKQILTNLQGKRIHISISLEAIDSAFCPGVSRP
CVQGLQVEEIFEIVYLAGKFCVGLDITDYNPTIEDYRTGFLLGNLIYYFILSKGKDIK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgatcccagattcaaaattgttgaaggaatagatggagattatgtgatcata
gggtttcctcatcatataggagccaaaagagacaatgttcgaattggataggaccatgga
cctgattctttaagaagattcttgcctagaattggtccattaaggaatgctgaatatatg
aaagatattagtaattttatagtttcggattatggaaatatacatgttgacgatgattaa
aatttagaaaaacttttggaaaaattgaatcagaaagtgaaaattgtacacaataagaat
cacattccaattgtaataggaggatccaaggattgtgtttttggtgttcttagtgatgat
ttgcatgtgatttcaattaatcatattcctgatattcaagtaccatatgatggcaataaa
ccaagtattaactcaggattaagagcatcgacaagtaaaatatcaattacctattttggg
tatgataatagcaaattaaattaagaataagaaaattatataaatgaaaaatgtaatgga
attagcttatagaagattaggtaagcatagaaggcatttcatcaagatctggaataataa
gttacacaggctggaattttatttaaataaatacttacaaatctttaagggaaaagaatt
catatttctatttctttagaagccatagattcggctttttgtcctggagtaagcaggcct
tgtgtgtaaggcttataagtagaagaaatatttgaaatagtttatttggcaggtaaattt
tgtgttggtttggatattactgattataatccaacaattgaggattatcgtacagggttt
ttattaggaaatctaatttattattttattttatcaaaaggaaaggatattaagtga

DBGET integrated database retrieval system