KEGG   Paramecium tetraurelia: GSPATT00012871001Help
Entry
GSPATT00012871001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K01479  
formiminoglutamase [EC:3.5.3.8]
Organism
ptm  Paramecium tetraurelia
Pathway
Histidine metabolism
Metabolic pathways
Module
Histidine degradation, histidine => N-formiminoglutamate => glutamate
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    GSPATT00012871001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.8  formimidoylglutamase
     GSPATT00012871001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 298 aa AA seqDB search
MSDDPRFKIVEGIDGDYVIIGFPHHIGAKRDNVRIGQDHGPDSLRRFLPRIGPLRNAEYM
KDISNFIVSDYGNIHVDDDQNLEKLLEKLNQKVKIVHNKNHIPIVIGGSKDCVFGVLSDD
LHVISINHIPDIQVPYDGNKPSINSGLRASTSKISITYFGYDNSKLNQEQENYINEKCNG
ISLQKIRQAQKAFHQDLEQQVTQAGILFKQILTNLQGKRIHISISLEAIDSAFCPGVSRP
CVQGLQVEEIFEIVYLAGKFCVGLDITDYNPTIEDYRTGFLLGNLIYYFILSKGKDIK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacgatcccagattcaaaattgttgaaggaatagatggagattatgtgatcata
gggtttcctcatcatataggagccaaaagagacaatgttcgaattggataggaccatgga
cctgattctttaagaagattcttgcctagaattggtccattaaggaatgctgaatatatg
aaagatattagtaattttatagtttcggattatggaaatatacatgttgacgatgattaa
aatttagaaaaacttttggaaaaattgaatcagaaagtgaaaattgtacacaataagaat
cacattccaattgtaataggaggatccaaggattgtgtttttggtgttcttagtgatgat
ttgcatgtgatttcaattaatcatattcctgatattcaagtaccatatgatggcaataaa
ccaagtattaactcaggattaagagcatcgacaagtaaaatatcaattacctattttggg
tatgataatagcaaattaaattaagaataagaaaattatataaatgaaaaatgtaatgga
attagcttatagaagattaggtaagcatagaaggcatttcatcaagatctggaataataa
gttacacaggctggaattttatttaaataaatacttacaaatctttaagggaaaagaatt
catatttctatttctttagaagccatagattcggctttttgtcctggagtaagcaggcct
tgtgtgtaaggcttataagtagaagaaatatttgaaatagtttatttggcaggtaaattt
tgtgttggtttggatattactgattataatccaacaattgaggattatcgtacagggttt
ttattaggaaatctaatttattattttattttatcaaaaggaaaggatattaagtga

DBGET integrated database retrieval system