KEGG   Paramecium tetraurelia: GSPATT00013754001Help
Entry
GSPATT00013754001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K08850  
aurora kinase, other [EC:2.7.11.1]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     GSPATT00013754001
Protein kinases [BR:ptm01001]
 Serine/threonine protein kinases: Other group
  Aur family [Table]
   GSPATT00013754001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 320 aa AA seqDB search
MWQTANSVLSIITNTYENTRGVECLDKKPQIQDPIEEETRNNYSENEDFNQADKEFDPTQ
WNLRNFEMGRYLGNGKFGHVYLARERESKFILALKVISKRQLNLCQLTGSLTREVEILTH
LKHPNIISFYGFFQTEKRVYLMLEWAPLGDLYGLMKKQQNKRFNEKMASNIIKQITMAIG
YMHSMNVIHRDLKPENILCFNDDVFKISDFGWSVHTPSNRRKTLCGTLDYLCPEMINYQP
HDNRVDVWTIGVLAYELVVGRPPFESHNENDTKRKIQHLQYQFPQWSSSDFQNFVKGILQ
HDCNKRPTIQQILNHPWIAQ
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgtggtaaactgcaaactcagttctatcgattattacaaatacttacgaaaacacaagg
ggagtggaatgtttggacaagaaacctcaaatctaggacccaatagaagaagaaactcga
aataattacagtgagaatgaggatttcaatcaggcagataaagaattcgatcctacttaa
tggaatttaagaaactttgaaatgggtaggtacctgggaaatggcaaatttggacatgtt
tacttagcgagggagcgtgaaagtaaattcatcctggctttgaaagtgataagcaaaaga
caactgaatctctgttaattgactggatctctaaccagagaagtagaaatactcacacat
ctcaaacatcctaatattattagtttttatggcttcttttaaacagaaaagcgtgtttac
ttgatgctagaatgggctccattgggagacttgtatggtttaatgaagaagtaatagaat
aagaggttcaatgagaaaatggcatcaaatattatcaagcaaataacaatggctatcgga
tacatgcattcgatgaatgtaatacacagggatttgaaacctgaaaacattttgtgtttc
aatgacgatgtgttcaagatttcagatttcggttggagtgttcacacaccatcgaataga
aggaaaacactatgtggtactttagactacttatgtccagaaatgattaattatcaacct
catgataatagagtggatgtttggacaattggagtgttagcatacgaattagtagttggg
agaccaccttttgaatcccacaatgagaatgacacaaaaagaaagatatagcatttgtaa
tactaatttccgtagtggagtagctcagattttcagaatttcgtaaagggaatccttcaa
cacgattgcaataagagacccacaatctaatagattttaaatcatccatggattgcttaa
tga

DBGET integrated database retrieval system