KEGG   Paramecium tetraurelia: GSPATT00014029001Help
Entry
GSPATT00014029001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K11252  
histone H2B
Organism
ptm  Paramecium tetraurelia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 125 aa AA seqDB search
MAPSKSPKAEAAKKTVKTVKTKKGSDDKKKARRRQETFALYIYKVLRQVHPEIGVSRKAM
NIMNSFINDIFDRIALEASKLVRFNKRRTLSSREIQTAVKLLLPGELARHAISEGTKAVT
KYTSG
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggcaccatcaaaatcaccaaaggcagaagccgcaaaaaagacagtcaagacagtcaag
accaagaagggctcagatgacaagaagaaagcaagaagacgataagagacattcgctctc
tacatttacaaagtcttgagataagtccacccagaaattggtgtttcaagaaaagctatg
aacattatgaactcattcatcaatgatatcttcgatagaattgcccttgaagccagcaaa
ttggttagattcaacaagagaagaaccctcagctcaagggaaatccaaaccgcagtcaag
ttgctcctcccaggagaattggccagacatgccatctctgaaggaacaaaagccgtcacc
aaatacacaagtggttga

DBGET integrated database retrieval system