KEGG   Paramecium tetraurelia: GSPATT00014519001Help
Entry
GSPATT00014519001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     GSPATT00014519001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 416 aa AA seqDB search
MANLFDEEQGQYLRLNALKYLEKPPEVQRQDDPFVTNGSLAITYILVETVEQYKSDQGLK
FQPSYVHQVFRQTNEIYGYKDLKITIHVTALRLKPFIQISYSEQTEDADDLQESFNKVYE
AGFLSTEEQFIKALEEEQNQEPLGELIEEYGDFRIYKCQTATTNGFIQFKPFLQAFLLVL
IDGVQYPGDENEWVYLTLYEKRRFVGLTTVFKFNIAWNKQRHRLSQMLFLPQYQRKGHGS
RMLRTVYKLGLEDEKCLQITLEDPSEDFQVMRDITDSIILHEHFKDIIPNKVINSIQEIV
EIPKEKLFEIMKKTKLHAQQIKQAYSIYLYAFINKKSSKLMTEFARYLLREHQKPYVRKR
NILVRFEDGSSLDPKQMHLLELKEKEDRNIIAEESLRDEFCLFELIATKLRKDKVI
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggcaaacctatttgacgaagagtaaggacaatacctaagattgaatgctctcaaatac
cttgaaaaaccacccgaagtctaaagacaagacgatccatttgttaccaatggctctttg
gcaatcacatatattctagtggaaactgtggagtagtataagtcagattaagggttgaag
ttttaacccagttacgtacatcaagtatttcgataaaccaatgaaatttacggttacaag
gatctcaaaatcacaattcatgtcacagcccttagattgaagccttttattcaaatatcc
tacagtgagcagacggaagatgcagatgatctctaagagagcttcaataaagtgtacgag
gctggcttcctttctactgaagagcaattcatcaaagcccttgaagaggaacaaaatcaa
gagcctttaggagaattaattgaagagtatggagacttcagaatatataaatgttaaacg
gcaaccacaaatgggtttatccaattcaaaccatttttataggcatttcttttagttctg
attgatggagtccaatacccaggtgatgaaaatgaatgggtttacttaaccttatatgaa
aagcgtcgctttgttggtttgactactgtgtttaagtttaatattgcatggaataaacaa
agacatcgtttgagtcaaatgctattcttaccataataccaaagaaaaggacatgggagt
agaatgttgaggactgtctataaattagggttggaagatgagaagtgcttataaattact
cttgaagatccatctgaagactttcaagtgatgagggacattactgactccataatcttg
catgaacatttcaaagatataataccaaataaagtaatcaattcaatccaagagattgtt
gaaatacctaaagaaaagctgttcgaaattatgaagaaaactaaattacatgcgtagtaa
ataaagcaagcctattcaatatatctctatgccttcattaacaagaagtcttcaaaattg
atgactgaatttgcgaggtatctactaagagaacattaaaaaccctatgttagaaagaga
aatattttggttcgatttgaggatggcagttcattggatccgaaataaatgcatctcctt
gaattgaaggaaaaggaagataggaatattattgctgaggaaagtttaagagatgaattt
tgtttgtttgaacttattgctacaaaattaaggaaggataaagtaatttga

DBGET integrated database retrieval system