KEGG   Paramecium tetraurelia: GSPATT00014942001Help
Entry
GSPATT00014942001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ptm  Paramecium tetraurelia
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSPATT00014942001
   01230 Biosynthesis of amino acids
    GSPATT00014942001
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GSPATT00014942001
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    GSPATT00014942001
Enzymes [BR:ptm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     GSPATT00014942001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   GSPATT00014942001
  Exosomal proteins of melanoma cells
   GSPATT00014942001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 236 aa AA seqDB search
MKIYYVRHGQSMNNVINDLSDLEYEQNRQQDPPLSESGVKQVKLLTDYLKLKNVEFEEIR
CSPQLRAIQTAQLISEGFKVPLKIQQNLHEKGGNQRMNKGFPGLTRKEFQNQYPEFEIDE
LIQDAGWYFKDKRETDEECTQRAEKVIQDLQKETKKSILIIGHGNFMDQVMGFVCGRAQN
SKYFYYHQNCGITLLKNDGYGFEIDYYNDYSFLDMHYIKTGEDLLLKRLANYKGKI
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttattatgttagacatggacaatctatgaataatgttatcaatgatctttca
gacttagaatatgaatagaatcgtcaataggatcctccactttctgaatcaggtgtcaaa
taggtaaaactattgactgattatcttaaattaaaaaatgttgaatttgaagaaattaga
tgttccccttaattaagagctattcaaaccgcataattaattagtgaaggatttaaagtt
cctctcaaaatataacaaaatctacatgaaaaaggaggtaattaacgtatgaataaagga
tttcctggattaacaagaaaagagttttagaatcaatatccagagtttgaaatagatgaa
ttaatacaagatgcaggatggtattttaaagataaaagagaaactgatgaagaatgtaca
taaagagcagagaaggtaatttaagatttacagaaagaaacaaaaaaatctatattaata
attggacatggaaattttatggattaggtgatggggtttgtttgtggaagagctcaaaat
tccaaatacttttattatcattaaaattgcggcattacattactcaaaaatgatggctat
ggatttgagatagattattataatgattattcctttcttgatatgcattacattaaaacc
ggagaagacttacttttaaagagacttgccaattataaagggaaaatttga

DBGET integrated database retrieval system