KEGG   Paramecium tetraurelia: GSPATT00015122001Help
Entry
GSPATT00015122001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
ptm  Paramecium tetraurelia
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    GSPATT00015122001
   00240 Pyrimidine metabolism
    GSPATT00015122001
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    GSPATT00015122001
   03410 Base excision repair
    GSPATT00015122001
   03420 Nucleotide excision repair
    GSPATT00015122001
   03430 Mismatch repair
    GSPATT00015122001
   03440 Homologous recombination
    GSPATT00015122001
DNA repair and recombination proteins [BR:ptm03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      GSPATT00015122001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 85 aa AA seqDB search
MNDDYSRTCTFEELKQRVPEKQPSQRQISVLIDQFDWDSKYGPYSGMTREERYNRAVNNG
LYPPPEIKNYLTSKPHPYSQFYKLC
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgaatgacgattattcgaggacctgtacttttgaagaactaaaataaagagttcctgaa
aaataaccctcatagagataaatttctgttctaattgattaatttgattgggattccaaa
tatggtccttattctggtatgacgagagaagaaagatacaatagagctgttaataatgga
ttatatcctcctccagaaatcaaaaattacttgacctcaaagcctcatccttattcttaa
ttttataaattgtgttga

DBGET integrated database retrieval system