KEGG   Paramecium tetraurelia: GSPATT00016286001Help
Entry
GSPATT00016286001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ptm  Paramecium tetraurelia
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    GSPATT00016286001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     GSPATT00016286001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 313 aa AA seqDB search
MDIPKQLLVFVNPASGKGHALREWNKAKPILDKFNVKYQVIMTQYQNHCHDYLLKEDLSN
VYGVVLVSGDGLPHEAINALYERPDWEQISQSITIGVLPGGSGNAFAKTLTKISQLECNS
ESCALLIAKGITRQMDLILLEMPQKKVVSFLSLAYAFISEVDLGSESLRFLGGARFDVYG
TWRAMFQKKYEAKYNNQQMIFRYFLAQKIPYISDNYLSAPAAKIDDGMIDVQYLEAGDWS
QLVKLSIKQYDGSHVEIDEQGNIKSKGNWKYEKVKEYTFEPITNCPLSIDGERYPPQPVK
AKVLSKILKVFCY
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atggatattccaaaataattattggtttttgttaatccagcaagtggaaaaggacatgct
ttgagagaatggaataaagccaagcccattcttgataaattcaatgtaaaataccaagtc
attatgacataatatcaaaatcattgccatgattatttattgaaagaagacctatcaaat
gtttatggagtcgtgcttgtctcaggagatggactaccacatgaggctattaatgcttta
tatgaaagacctgattgggaataaatatcgcaatctattactattggggttctcccaggt
ggaagtggaaacgcatttgctaaaaccttaactaaaatatcacaattagaatgcaactcg
gaaagttgtgctcttctaatagcaaaaggaatcaccagacaaatggatcttattttacta
gaaatgcctcagaagaaggtggtctcatttttatccttagcctatgcctttatttctgaa
gttgatttaggatctgaatcacttaggtttttgggaggagccagatttgatgtatatgga
acatggagagctatgttttaaaaaaaatatgaggcaaaatacaataatcaataaatgatt
tttaggtattttttagcatagaagataccttacataagtgataattatttatcagcacct
gcagctaagattgatgatggaatgattgatgtataatatcttgaggcaggagattggtcc
caattagtcaagttgtccataaaataatacgatggcagtcatgtagaaatcgatgaatag
ggaaatataaaatctaaaggaaattggaaatatgaaaaagtaaaagaatatacatttgaa
cctattactaattgtccattgagtatagatggagagagatacccaccacaaccagttaaa
gccaaagtactaagtaaaattttgaaagtattttgctattga

DBGET integrated database retrieval system