KEGG   Paramecium tetraurelia: GSPATT00016352001Help
Entry
GSPATT00016352001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
ptm  Paramecium tetraurelia
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:ptm03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 641 aa AA seqDB search
MFGGSMFGNQNPTQTSGGIGGILGNFGAPTGVQGGLFPNTAPQQGLFGQVQGTQGQPGFG
GLMGGQMQQGGLGGGLGGGLGGGLGGGLGGQLGGGLGLQQQQSSTFGAPGGLGQPPVLGQ
QAPTFGGLGGGLGTGLGGSLGTGFGQQPGLLGQTTQQGGLFGQTPQSGGGLFGQQQQQQQ
PTLFGQQPQQPQQQATGLFGAPAPAAQPFGQQQGGLFGQTPQQPQQTGFGFGQQQTAAPG
TSLFGQQQPQQQVQPGLGFGGGLGQQGQVGNQIVLPGGVDDSVNDASLEQRIRLEDSVSA
ICWGTTIPNFLAISSWDGKVRILEIQQNSYKRELFERRSFQVDGAVGQVQNPIVCMDAKG
DLSQIFVGCGFDHTVRVIDVNSGQMVSVGQHQALIISVYWIESAQMILSISTDQSLKMWD
IRAPGQPRFQCQFQYKPMVSDCNFPLLVIGFASEKLTIINLNELQQLPGRFQYIDSPLGT
YSQLTSIAIFPARDGFTLGSIDGRGHQTNITTKSTHGMPTEFSLKSIMTFKAHKVEDNQK
GKIQNYFFPVNCIQMNIKNNYFLMTAGGEGQMIFWDINVRNKIRTFQFNCNPIVCAKMSP
DGSMLAYALGNDFSKGPEYFNEFQPKIFVHFIPENELRYPK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgttcggaggtagtatgtttgggaactaaaatccaacttaaacaagtggaggaatagga
ggtatattaggtaattttggggcaccaactggtgtataaggaggactatttccaaataca
gctccataataaggtttatttggttaagtacagggaacacaaggacaacctggttttggt
ggtttaatgggaggttagatgcaataaggaggattaggcggaggccttggaggtggtctt
ggaggaggcctcggaggaggtctaggaggttagcttggaggtggactcggactttaacaa
taataatcaagcacatttggagcgcctggcggattaggctaacccccagtattaggataa
caagcacctactttcggtggcttaggaggagggttaggaacaggattaggtggctcactt
ggaactggatttggataatagcctggattattaggttaaacaacttagcaaggaggatta
tttggttaaactccttaaagtggaggaggactatttggatagtaataataataataatag
ccaaccttatttggttaataaccttaataaccataacagtaagcaacaggtttatttggt
gctccagctcctgctgcttaaccctttggataacaatagggaggcttatttggatagaca
ccttaataaccacaacagactggatttggatttggataataataaactgctgctcctggg
acttctctttttggttaataataaccttaataataagttcaaccaggtcttggatttgga
ggtggattaggacaataagggtaagttggtaattaaatcgtattgcctggaggtgttgat
gattcagttaatgatgcaagtttggaatagagaattagattggaagattcagtttcagca
atatgttggggaacaaccatacctaatttcttagctatatcttcttgggatggtaaggtc
agaatattggagatccaacaaaactcatacaaaagagaattatttgaaagaagatccttt
taggttgatggagcagttggataagtataaaatccaatagtttgtatggatgctaaggga
gatttgtctcaaatattcgtaggatgtggatttgatcacacagtcagagttattgatgtt
aattcaggctagatggtttcagtaggacaacattaagcattaataatttctgtttattgg
atagaatcagcataaatgatattatcaatatctacagattaatcattaaaaatgtgggat
atcagagctccaggataaccaagattttaatgtcaattctaatacaaaccaatggtatct
gattgtaatttcccattattggttattggatttgcatctgaaaaattaacaatcattaat
ttgaatgaattgtaatagttaccgggtagattttaatacattgattcaccattgggaacc
tattcacaattaacttcaatagcaatatttccagcaagagatgggtttactttgggatcc
attgatggtagaggacattagacgaatattacaaccaaatccactcacggaatgcctact
gaattttcattaaaatcaatcatgacttttaaagctcataaagttgaagataatcaaaaa
ggaaaaatttaaaactatttctttcctgttaattgcatccaaatgaatatcaaaaacaac
tactttttaatgacagctggaggagaaggtcaaatgatcttttgggatattaatgttaga
aataaaatcagaacattttaattcaattgtaatcctattgtctgtgccaaaatgagtcct
gatggttccatgctagcatatgctttaggtaatgatttttcaaaagggcctgaatacttc
aatgaattttaaccaaaaatatttgttcattttattccagagaatgaactaagatatcct
aaatga

DBGET integrated database retrieval system