KEGG   Paramecium tetraurelia: GSPATT00017058001Help
Entry
GSPATT00017058001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K11825  
AP-2 complex subunit beta-1
Organism
ptm  Paramecium tetraurelia
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    GSPATT00017058001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 938 aa AA seqDB search
MSRPSASTSSNSRSSRSRYGKEVKELQDALNQNKIESKRDAIRKIIDAMTRGKDVSMLFP
DVAKNMETANLELKKLVYLYIINYAKIMPDLAVMAINSFRKDARDKTNPFLRALAIRTMG
CIRVKHITEYLLDPLKESIKDEDSYVRKTAAICISKLYDVSPELIDEQGLLKLLENLLND
GNAMVVANAVCALLIVQESKGTTMLQLNAQTIQKILTAMNECNEWGVIYCLDALALYIPE
DGKEAEAILERVSPRLNHSNPGVVLSACKIMMKFLDYLQNPEIIRQNALKMTAPLISLLS
LGKEPEIQYVALKNINLIIQKRPIIIEKEIKVFFCNFNDPIYIKLQKLEVLSKIANQDNI
QQILHELKEYTQEVDVEFVRKSVRTIGRCAIKLEKSAEKCVTALWECLKTKVNYVVMECI
IVIRDIFRKYPRKYEMILKDLCENLKSLEDPEAKASMIWIIGEYVDTIENADDLLSNFIE
NFKDEPANVQNQMLVAVMKLFLQRPVDGKEIIHNLLKVATTECENPDVRDRAYIYWRMLS
TDPELAKKIVFSERPPISDASYTLENELLDKLIENIGNLSSVYTKKPESFVKKLREVLNS
KMQDKPEEVYEGEQLMDGRPEDYSDQQAGPQSNVYEGNYETSSQIQQQTNAQSQIQQVLQ
NIDLLDLDDSQERQQQPPPSSQQQQQQQQQQQQQQQLQQNIKLPFSEVLSSITSGAQQKI
VGLQIEGAFQKNGDQIILELKFANKTQDKTFQGFGIKFNNNPFRLQPDSIEISSPPIQPG
QSLITQIFVNLNGPACQDAPQMPYRIQVALKTNLDVFYFLIPMSLSVLFSSNGQITQQKF
VELSQAQNYARKNEILQLQVDYQKMREKLERNYLYLVGIRKDDKGVELLSYSVVLANGMS
ILINVIHTTNAINLQLQAPHPTLIPLIFQALGFILTIN
NT seq 2817 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgaccctctgcatcaacttctagtaattctagaagctcaagatcgcgttatggt
aaggaagtcaaagagttgtaggatgctttgaattaaaacaaaattgaatcgaagagagat
gcaatcagaaaaattattgatgctatgactagaggtaaagatgttagcatgctctttccc
gatgtcgctaaaaatatggaaaccgccaatttggaacttaaaaaattagtctatttgtac
atcatcaattatgcaaaaatcatgccagaccttgcagttatggctataaatagctttaga
aaagatgctagagacaaaactaatccatttttaagagcattagccatcaggaccatggga
tgtataagagtaaagcatatcacagaatatttattggatccattaaaagaatcaatcaaa
gatgaagattcctatgtcaggaaaactgcagctatttgtatttctaaattatatgacgtc
tctccagaattgatcgatgaataaggacttttgaagctattagaaaatcttcttaatgat
ggcaatgctatggtagttgcaaatgctgtatgcgctttactaatagtataagaatctaaa
gggacaactatgctccaattaaatgcttaaacaatttaaaaaatattgacagccatgaat
gaatgtaatgaatggggtgtgatttattgtcttgatgctttagcactctatattccagag
gatggaaaagaagcagaagctatattggaaagagtcagtccacgattgaatcacagcaat
ccaggagtggttttatcagcctgtaaaattatgatgaaattccttgattatctttaaaat
ccagaaattattagataaaatgcacttaaaatgactgccccattaatttctttactgagc
ttaggtaaagaaccagaaatataatatgtggctctaaaaaatataaatctaatcatttaa
aagaggccaattattattgaaaaggaaattaaagtattcttttgtaatttcaatgatccc
atttatattaaattatagaaactggaagtgttatccaaaatagctaattaagataatatt
caatagattttgcatgaattaaaagagtacacacaagaagttgatgtcgaatttgttaga
aaatcagttagaactataggtagatgtgcaattaaattggaaaagtctgcagagaaatgt
gttactgctttatgggagtgtctgaaaactaaagtgaattatgttgtgatggaatgcatc
attgttattagagacattttcagaaaatacccacgcaaatatgaaatgatcttaaaggat
ctatgtgagaatctaaaaagcttagaagacccagaggccaaagcatctatgatttggatc
atcggagaatatgtagatacaattgagaatgctgacgatttattgtctaattttattgag
aatttcaaagacgaaccagctaatgtgtaaaattaaatgttggttgcagtgatgaaattg
tttttgcaaagaccagtagacggaaaagaaattattcataatttattaaaggtagcaaca
acggaatgcgaaaatccagatgtgagggatagagcttatatttattggagaatgctatca
actgatccagaattagcaaaaaagattgtgttctcagagagacctcctatttctgatgct
agttacacacttgaaaatgaactcttagataaattaattgaaaatattggaaatctcagt
tcagtttatacaaaaaagccagaaagctttgttaaaaaattgagagaagtcttaaattca
aaaatgtaagacaaaccagaggaagtatatgaaggtgaataactaatggatggaagacca
gaagattatagtgattaataagcaggtccataatcaaatgtttatgaaggaaattacgaa
acatcatcataaatacaataataaactaatgcgtaatcataaatttaataagttttataa
aatatagatttattggatttagatgattcataagaacgacaataataacccccaccatca
tcataataataataataataataataacaataacaataacaataacaactataataaaat
attaaactaccattttctgaagtccttagttccattacttcaggagcataataaaaaata
gttggactttaaattgaaggtgctttctaaaaaaatggagatcagattatcttagaatta
aaatttgccaacaaaactcaggataaaactttttaaggttttggaattaaatttaacaac
aatccatttagattataaccggattctattgaaatttctagtccacctatctaaccagga
taaagtttgattacttaaatctttgtaaacctaaatgggccagcttgctaagatgctcct
taaatgccttatagaatataggttgcactgaaaactaatttagatgtgttttattttctt
atccccatgtcacttagtgtgttatttagctctaatggttaaattacttagcaaaaattt
gttgaattaagtcaagcttagaattatgcaagaaaaaatgaaattctttaattgcaagtt
gattatcaaaaaatgagagagaagctagagagaaactatttatatttagtaggaattagg
aaggatgataaaggagttgaattattatcctactctgttgtcttagctaatggcatgtca
atcttaattaatgtcattcacactacaaatgcaatcaatttataattataagctcctcat
ccaacattaattccattaatattttaagctttagggtttattttaacgataaattga

DBGET integrated database retrieval system