KEGG   Paramecium tetraurelia: GSPATT00017260001Help
Entry
GSPATT00017260001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ptm  Paramecium tetraurelia
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ptm01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ptm00630]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 514 aa AA seqDB search
MNRLSQLSGQYDEEQMLQQQIIELDNWFKSPRFNNVLRPYTAKQVAEVRGQIVPNQFSDF
MARKFYKLMMDLKKSKGFSLACGALDTVQVINMSKYMTSIYVSGWQCSSSASTTNDPGPD
FADYPYDTVPKKCDQLVKMQRFQDRRQQYERSLITAEQRKQKKPYDYLVPVICDADAGFG
GTSSVMKLTKLFIESGAAGIHLEDQRPDLKKCGHMAGRVVTSTNTHVQKLIACRLQADIM
GNELFIIARTDALGARFIETNVDLIDQPYILGVTKFHDRPCTYPEAGVFIIEQMIDKDKR
IQATNQWLNQCEIGGIKKAKDLAKRLGFELEFDWEQCRNPDGFYALKSSVHYCAIRAKEY
LKYADALWMETSTPDLKVAKELSDELQFELQHNKVLCYNCSPSFNWSKFGFSDSELKNFN
SELGKLGYTWQFITLAGFHLNALQSERFSKDLSERYMLAYVEDIQRKEEKHNVDQLRHQK
WSGAEIIDHVMTIVNQSTLISSGEDSTEHQFDNK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaatagattatcctaattgagtggacaatatgatgaagagtagatgttgcagtagtag
ataattgaattggataattggttcaagagtccgcgtttcaataatgtcctgcgtccatac
acagctaaataggttgctgaagtaagaggatagattgtgcctaaccaattctctgatttc
atggcaaggaaattctataaactcatgatggatttaaaaaaaagcaaaggattctcactt
gcatgtggagctctagatactgtttaggttattaatatgtcgaaatacatgacatcaata
tatgtatcaggttggcaatgttcttcttcagcttctacaacgaatgacccaggacctgat
tttgctgattatccatatgacactgtgcctaaaaaatgtgattagttagtcaaaatgcaa
agattttaagacagaagatagtaatatgaaagaagcctaattactgctgaataacgaaaa
taaaaaaaaccttatgattatctagttcctgtcatttgtgatgcagatgcaggatttggt
ggtacaagcagtgtaatgaaattgacaaaattatttattgaatctggagctgcagggatt
catttggaggattaaagacctgatttgaagaaatgcggccatatggctggaagagttgta
acatctactaacactcatgtctaaaagctcatagcctgtagactttaagctgatatcatg
ggaaatgaattatttattattgcaagaactgatgccttaggtgcacgattcatagaaaca
aatgtagatttgattgattaaccatacattcttggagtaacaaagtttcatgatagacct
tgcacttatccagaagcaggagtttttataatcgaacaaatgatcgataaagataagaga
atataagccactaattaatggttgaaccaatgtgaaattggaggaatcaaaaaagctaag
gacttagcaaagagattaggatttgaacttgaattcgattgggagtaatgtagaaatcct
gatgggttctatgctcttaagagtagtgttcattattgtgcaataagagctaaagaatat
ttaaaatacgcagatgctttgtggatggaaacctcaacacctgatttgaaagttgccaag
gaactctctgatgaattacaatttgaactttagcataataaggtcctttgctataattgt
tctccaagttttaattggagtaaattcggattctcagacagtgaactcaaaaactttaat
tctgaattagggaagttagggtatacttggcaatttattacattggcaggatttcattta
aatgcattacaaagtgaaagattctctaaagatttatccgagagatatatgctggcctat
gttgaggatatttaaagaaaggaagagaaacataatgttgattaattgagacatcaaaaa
tggtctggagctgaaataatagatcatgttatgactattgttaatcaaagtacattgata
tcttcaggcgaagactcaactgaacattaattcgacaacaaatga

DBGET integrated database retrieval system