KEGG   Paramecium tetraurelia: GSPATT00017718001Help
Entry
GSPATT00017718001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
ptm  Paramecium tetraurelia
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 1153 aa AA seqDB search
MICPQYLLDSINNCNERVIKRAYERLEGKQNLVEVCQQLKQSLRTQLSLHNVQEKKTDSK
ISIYYLTDISQLALLLLALCSYKLNDFNLSYLISYFGCSQETPSQDSLEFDQVEWRKLEL
EWISIQSLQKMNQLQECIDKIEIVQKLIQTSKNKKTWAQLDIILDQKKSYLQDYIDNKQK
TFQTYNDEEKTALAKKLQQLLLKQEQDRYFEQEGYPAYLISSQWIARFSLYTKYYELTRE
NPDSLKQFIAKKNNSMDDETFVEIFKQYCNQQTYEELERISNSTQNNTDIHICPIYNDDL
IDTQTSFEKDPLKAKSYSNYALNKSIRENQNFIFVSSQIWRFLYGLFGGVEIKRLVLCRS
RHAVETHLFQVRCQLFPQQQQRIINLQFNGNERIEDLVNKVNRITSQKVRNVWKIPKEVN
QEELMKSQQVVGTKISRDNILEQAEIGPEEVLLLELEQEQYRLEKKENLQTISIPNKCMS
CGNQDSQLYLCECRSVKYCNETCQANDLKNHQDVCKKIMEKDSLINQLSKKYKVKPPAKI
VKNSAKGICGLSNLGNTCFMNSSLQCLSNVTELTEYMIYNTYLEDLNEKNPLGTGGRLAC
NYAELLKELYESTSTSVAPWNVKKVIGQQAPQFNGYSQQDSQELLSYLLDGLHEDMNRIK
KKPYIPEVEYKGQSDQEFADIYWDNHKKRNDSKITELFTGQFKSRVECPECNFVSITFDP
FVTISLPIPSKEYVQFQFYLIFRDSNQTPLKIQQTLQSTQTAGEIIEIISKIKNIKAEYL
KFYSLQDSAIIDNGISSEQTIKQIKESQATTFLYEEYDEKIDKPNSKYDSNIKTPYHQVL
CNVKKLEESKLNQQNYRISFTRVCYVDSQTTYQGLHLIIYQIFRTHLIQISEITSNLNLN
KEFEQFLKNIKKFVYKDYFEEYQDLLKLKELIYQLQDDNCKPLPFTDKQIEVSGKSINLN
AQFKLRAELLKLNRCVDAEFTLQGPNQSLQQTISLNDCLNQFCQEEVLGAGNEWYCSKCK
KHQKAKKQMQIYKAPQIMILHLKRFRSTRVTQFYGTYSVGGVTKIVQFVDFPLENFDIQP
FILEKESQQPYVYDLFAISNHYGGMGGGHYTAYAKNPMYNAWFDFNDSQVKELRSNPVTD
AAYVLFYRRRKVK
NT seq 3462 nt NT seq  +upstreamnt  +downstreamnt
atgatttgtccttaatatttattggattccatcaataattgtaacgaaagagttatcaag
agagcatatgaaagactggaaggtaaacaaaatctagtagaggtgtgttaataattgaaa
taatctttaaggacacaattaagcttacataatgttcaagaaaaaaagactgacagtaaa
atttccatttattatttaacagacatcagttagttagcattattactattagcactttgt
agctataaattaaatgatttcaatttaagttatttaatttcttactttggatgttcgcaa
gaaactccatcataagattcacttgaattcgactaagtagaatggcgaaagttagaatta
gaatggatatcgatacaatccttataaaaaatgaatcagttataagaatgcattgataaa
atagagattgtttaaaaattaatataaacgagcaagaataaaaaaacatgggcttaatta
gacattattttagattagaagaaatcatatttgcaagactacattgataataaatagaaa
acattttaaacatataatgatgaagagaaaacagccttagcaaagaaattacaataatta
ttactaaagtaggaataggatcggtattttgaataagaaggctatcctgcttatttaatt
agttctcaatggattgctcgttttagtttatacacaaaatattacgaattaacaagggaa
aacccagattccttaaaataattcatagcaaaaaagaataactctatggatgatgaaaca
tttgtagaaatatttaaataatactgtaatcaataaacatatgaagaattagaaagaata
tcgaattcaacccaaaataatacggacattcatatctgtccaatttataatgatgattta
attgatacataaacatcatttgagaaggacccattgaaagcaaaaagctattccaattat
gctttaaacaaatctataagagagaattagaatttcatttttgtcagtagttagatatgg
agattcttatatggattatttggaggagttgaaataaaaagactcgtcttatgtagaagc
agacatgcagttgaaacacatttatttcaagttagatgctaattattcccataacaataa
taaaggataataaatttataatttaatggaaacgaaaggattgaagaccttgttaataaa
gtaaataggataactagttaaaaagtcagaaatgtttggaagattcctaaagaagtcaac
taagaggaattaatgaaaagttaataagttgttggtactaaaataagcagagataacata
ttagaataagctgagataggacctgaggaagttttacttttagaattagagtaagaataa
tatagattagaaaaaaaagagaatttgtaaacaatatcaattcctaataaatgcatgagt
tgtggtaatcaggattctcaactttatttatgtgaatgcagaagtgttaaatattgcaat
gaaacctgtcaagctaatgatttaaagaatcattaagatgtttgtaaaaaaatcatggaa
aaggattccttaatcaatcaattatctaagaaatataaagtgaaacctccagctaaaata
gtcaaaaattcagccaaaggaatctgtggattaagtaatttaggaaatacttgctttatg
aattcaagtttgcaatgtttgagtaatgtcactgaactaactgaatatatgatatacaat
acttatctcgaagatttaaatgagaaaaatccattaggaactggaggtagattagcttgc
aattatgctgaattgttaaaggaactttatgaatctacatcaaccagtgtagcaccttgg
aatgttaaaaaggtgattggataacaggctcctcaatttaatggttatagttaataggac
tctcaggaactactctcatatttattagatggtttgcatgaagacatgaatagaattaaa
aagaaaccttacattccagaggtagaatacaagggttagagtgattaggaatttgcagat
atatattgggataatcataaaaagagaaatgattctaaaattactgaactcttcacagga
taatttaaatctagagtagaatgtcctgagtgtaattttgtatccattacatttgatcct
tttgttacaatttcattacccattccaagcaaagaatacgtttaattttaattttattta
attttcagggattctaatcaaacccctttaaaaatttaacaaactttacaatctacacag
acagctggagaaattatagaaatcatttcaaagataaagaatatcaaagctgaatatctc
aaattctattccttacaagattcagctataattgacaatggaatatcatcagaataaact
atcaaataaatcaaagagagttaagctactacatttttgtatgaagaatatgatgaaaag
atagataaaccaaattctaaatatgattctaatattaaaacaccttatcatcaagttctc
tgtaatgttaaaaaactagaagaaagtaaacttaatcaatagaattatagaatatctttt
actagagtttgctatgttgatagtcaaacaacttattaaggtctccaccttattatatac
tagatattcagaactcatttgattcaaattagtgagatcacttcaaatttgaatttaaat
aaggaatttgagtagttcttaaagaatatcaagaaatttgtttataaagattactttgaa
gaatattaggatttattaaaattgaaagaattaatatattaactctaagatgataattgt
aagcctctgccctttacggataaataaatagaagtaagcggaaagtccattaacttaaat
gcccaatttaaattacgagctgaactcttaaagttgaatagatgtgttgatgcagaattt
acactctagggtccgaatcaaagtttgtagtaaaccatctctttgaatgattgtttgaat
taattttgttaagaggaagtcttaggagcaggaaatgaatggtattgttctaaatgtaaa
aaacatcagaaggcaaaaaagcaaatgcaaatatacaaggcaccataaattatgatatta
catctgaaaagattccgatcgacaagagtgacataattttatggaacctactcagttgga
ggagtcactaagattgtctaatttgttgattttcctcttgaaaatttcgatattcaacca
tttattttagaaaaagaatcttaacaaccttatgtttatgatttatttgcaatttcaaat
cattatggaggcatgggaggaggacattacactgcatatgcaaagaatcctatgtataat
gcctggtttgattttaatgattcttaggttaaagaattaagatctaacccagtcacagat
gctgcttatgttttattttataggagaagaaaggtaaaatga

DBGET integrated database retrieval system