KEGG   Paramecium tetraurelia: GSPATT00017786001Help
Entry
GSPATT00017786001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ptm  Paramecium tetraurelia
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    GSPATT00017786001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     GSPATT00017786001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GSPATT00017786001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 492 aa AA seqDB search
MQSVIGSIDSSTTGTRFTICNLNGEQLSYHYITHKQITPHQGWLEHDPNEILNNTIECIK
QAHKKMDGVHKLVTIGVTNQRETVVAWNKHTAIPYMNAIVWSDTRTHDICQEYLNKYPKN
YFQQKTGLPINTYFSSYKLQWMIQNNQALRDDLNSGNVLFGTIDCWIVWNLTREQNHLTD
VTNASRTNLMNLHTLQWDEDLLNQFNIPKNCLPQIKASNSNFGSLKIEEYEGVPINCVLG
DQQAAAIGHALFHEGDCKNTQGSGLFIMANIGENIKISDFGLLTTVLYQKENEKPVYAFE
GAVESGGQLFNWAKDKLQWFENWEQLSQSTVNAEDNGGVYIVPAFSGLFTPFWNFDATGT
MIGLSYYTTKDHIRRAILESVCYRTKDVIKAMEQSGIKINKIHVDGGLTKNKELMQLQAD
ITQKKLVYPEIIESTASGAAMFAAVGLNLLTEQQIIQNMKVQQIYEGKKSYEKQYKQWEL
AVNCALQFKKIE
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtaatctgtaattggatctattgattcctcaacaactgggactagatttactatttgc
aatttgaatggtgaatagcttagttaccattatataactcataaacaaatcactcctcac
caagggtggttagaacatgatccaaatgagatattaaataatactattgagtgcattaag
taagctcataagaagatggatggagtgcataaattagtgaccattggagtcacaaattaa
agggaaactgttgttgcatggaataagcatactgcaataccatatatgaatgcaattgta
tggagtgatacaagaacacatgatatctgctaagaatatttaaacaaatatccaaagaac
tatttttaataaaaaactggattaccaattaatacctactttagctcatacaaattgtaa
tggatgatccaaaacaatcaagctctaagagacgatctcaattcagggaatgtattattt
ggtactattgattgctggattgtatggaatttaacaagggaatagaatcatttaacagat
gtaacaaatgcatcaagaactaatttgatgaatttgcatactctttaatgggatgaagac
ttattaaatcaattcaacatccccaaaaattgtttgcctcaaataaaggcatcaaatagt
aattttggttcattgaaaattgaggagtatgaaggtgtacctatcaattgtgtcttgggt
gattaataagcagctgctataggtcatgctttatttcatgaaggagattgcaagaataca
cagggaagtggactttttattatggctaacattggagagaatattaaaatctcagatttt
ggcttgttgactactgtcttatactagaaagaaaatgagaagccagtttatgcttttgaa
ggagctgttgaaagtggagggtaattgttcaattgggcaaaggataaactataatggttt
gaaaattgggaataattgagttaaagtactgtgaatgcggaagataatggaggagtctac
atagtgccagcatttagtggtttatttactccattttggaatttcgatgcaacagggact
atgattggtttaagttattacacaacaaaggatcatatcagaagagctatattagaatca
gtttgttatagaacaaaggatgttataaaggccatggaataatcgggaattaagattaat
aagattcatgtggatggtggattaactaagaataaggaattgatgtaattgtaagcagat
atcactcaaaagaagttagtatatccagaaataattgaatctactgcttcaggagctgcc
atgtttgctgcagtgggattgaatctattgactgaacagtagattatctagaatatgaag
gtctaataaatttatgagggcaaaaagtcttatgagaagcaatacaaataatgggaatta
gctgttaattgtgctttgtagttcaaaaagattgaatga

DBGET integrated database retrieval system