KEGG   Paramecium tetraurelia: GSPATT00017928001Help
Entry
GSPATT00017928001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
ptm  Paramecium tetraurelia
Pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
Enzymes [BR:ptm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     GSPATT00017928001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 298 aa AA seqDB search
MFKFLLRPSSLFSKRTTKLKHLIQSKELEFIMEAHNGLSALIVQEAGFKGIWASGLSMSA
QLGVRDCNEASWTQLLEVLEFMAERTTIPILMDGDTGFGNYNNARRLVRKLEERGIAGVC
FEDKIFPKRNSLGDGAQELANIQEFSNKIKACKDHQRDKDFQIVARCEAFIAGWGLDSAL
ERCEAYRKAGVDAVLIHSKKSDFTEIEQFLKAWNNRLPVVLVPTNYYKTPTEEFRKNNVS
LAIWANHNLRASVKAMQDTSKQIFERQNLLGLDQIASVKEVFRLQNEKGLEEDDKKYL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaatttcttcttaggccctcatcattgttttccaaaagaacaaccaaactcaag
catttgatctaatcaaaagaattggagtttatcatggaagctcataatggactatcagct
cttatagtgcaagaagcaggtttcaaaggcatttgggcttcaggattatcaatgtcagct
taattgggagtaagagattgcaacgaggcttcttggacttaattgttggaagtcttagaa
ttcatggcagaaagaactacgattccaatattaatggatggcgatacaggatttggaaat
tacaataatgcaagaagattagtaaggaaattggaagagagagggattgctggagtgtgt
tttgaagataagatcttccccaaaagaaactctttgggtgacggggcctaagaattggca
aacatttaggaattttcaaataagatcaaggcatgcaaagaccattagagggataaagac
ttttagatagtggctagatgtgaagcattcattgctggatggggtttggatagtgcctta
gagagatgtgaagcttacagaaaggctggggttgatgctgttttgattcacagtaagaaa
agtgattttacagaaatcgagtaatttttaaaggcttggaataatcgattgccagttgtg
ttggttccaacaaattattacaagacaccaactgaggaatttagaaaaaacaatgtaagt
ttggcaatatgggctaatcacaatttaagggcgagtgtaaaggccatgcaagacacaagc
aaacaaatatttgagagacaaaatttattgggattggattagatagcgagtgttaaggag
gtgttcagattgtaaaatgagaaagggttagaggaggatgataagaaatatttatga

DBGET integrated database retrieval system