KEGG   Paramecium tetraurelia: GSPATT00018017001Help
Entry
GSPATT00018017001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     GSPATT00018017001
Peptidases [BR:ptm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   GSPATT00018017001
Exosome [BR:ptm04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   GSPATT00018017001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 766 aa AA seqDB search
MTSTCEHINEQHITWSVKGQMIYKNQCTRCFVEAKSENGIQVCLKCFNGGCIEIHSPQHS
YQHNHYIVLNIRLYEIEQQKQSVDEITQQVIEDIPQLDFETSVICLKCQKMLNSPQLDGL
IQSIKQTNATSFGLIIDEYTIQPCQHTLTIQQRQLVVKNLQKCRRCRLSTNLWLCLQCGH
VGCGRKIFDGSGGNNHAVDHFVELQHHLVVKLGTITSDGQADVFCYKCDDAVVDKLLKEH
LATYGIEIEKQVKTEKTMAELTQDKILVLQLSKLIEEGQVLDPIFGPGFTGIDNIGNTCY
MNSVIQVIFSIHEFKQLYSLEHQFNCTSLPYNCVLCQICKVNHGLNSGEFSIKKESKNVQ
GTFRNFYQDGIKPYDFKLLVAQGNSNFLFNHQQDAQEYWQLLNSFFQKTEKQFKLPQLSS
IFSYDQTTILKCENCGGHKVNVVKNQEFKVPVEQPTQDQIDLYRKQEKQKYEERIKTMKP
EDIKPFSLKDIPEYVTTFERCLQLVKEGERVDIVCPSCQSLQSFIKQEYFKTFPKYLFVP
VNRFVQENWVPKKLNASIKIKEIYDFSDFKEPVLQDKDAIKEQTEQEYTEDTLQILMGMG
FGENRCKRALIKFKNDIEAAMIFIMKSLDDPTQDQPLKQKEQINEKFIEQIVIMGFSHDQ
ARFALSKTDNDLKRAMDYIFNHDLEAEMNQTQAKQQQQKQDQFDNQTSKYQLFACIVHLG
KSVQSGHYVSYIKKNGEWILYNDSKVAKIADPALNKGYMYIFKRLD
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
atgactagtacatgcgaacacatcaacgaataacacatcacttggtcagtcaagggataa
atgatatacaagaattaatgcactcgttgttttgtggaagcaaagagtgaaaatggcata
taagtgtgtttgaaatgttttaatggaggttgcattgaaatacacagtccgcaacacagt
tattaacataatcattacattgttctgaacattagattatatgagattgaatagcaaaaa
tagagtgtggatgaaattacttaataagttatagaagatattccataactggactttgaa
acaagtgtgatatgtttgaaatgtcagaaaatgttgaattctccttagttggatggatta
atttaatcaattaaataaactaatgctacttcatttggattaataatagatgaatacaca
atttaaccatgtcaacataccttaactatataatagagacagttagttgtaaaaaatctg
tagaagtgcagaagatgtcgtttatctactaatttatggctatgtttacagtgtggacat
gttggttgtggtagaaagattttcgatggatcaggaggaaataatcatgcagtagatcat
tttgtagaacttcaacatcatttggttgtcaaattgggaactattacctcagatggttaa
gccgatgtattttgctataaatgtgatgatgctgtggtagataaacttcttaaagaacat
cttgctacttatgggatcgaaatagaaaaataagtgaaaactgaaaaaaccatggctgaa
ttaacttaggacaaaattttagtattgcaattgagcaaattgatagaagaggggcaagta
ttggatcctatttttggaccgggatttacaggaattgataatattggaaatacatgttat
atgaattcagtgatctaagtaatttttagtatacatgaatttaaataactatactctcta
gaacattaattcaattgcactagtttaccatacaactgtgtattatgtcaaatatgtaag
gttaatcatggtcttaatagtggtgaattttcaataaagaaagaatcgaagaatgtacaa
ggaacatttagaaatttttattaggatggaattaaaccatatgatttcaagctgctagta
gcctaaggaaattcaaacttcctctttaatcattaataagatgcataggaatattggcaa
ttattaaattcattctttcagaaaactgaaaaacaatttaagttaccataattatcttct
atcttctcatatgattagactactattttaaaatgtgagaattgcgggggacataaagtt
aatgtagttaaaaattaagagtttaaagtccctgttgaataacctacttaagattaaatt
gatctttatcgtaaacaagagaaatagaaatatgaggagagaattaaaacaatgaaacca
gaggatattaaaccattctcattaaaagatatacctgagtatgtcacaacattcgaaagg
tgtttgcaactagtgaaagaaggagaacgtgtagacatagtctgtccttcatgttaatcc
ctgtaatcatttatcaaataagaatactttaagactttccctaaatatctctttgtacct
gttaacagatttgtctaagagaattgggttcctaagaaattgaatgcatcaataaagatc
aaggagatctatgactttagtgacttcaaagaacctgtgctctaagacaaagatgcaata
aaagagtaaactgaataggaatacacagaagataccttacaaattttgatgggaatggga
tttggtgagaatagatgcaaacgagcactcatcaaatttaagaatgatattgaagctgct
atgatttttattatgaaatcactagatgacccaactcaagatcaaccattgaaatagaaa
gaacaaataaatgaaaaattcattgaataaatagttataatgggattcagtcatgactaa
gccagattcgctttatctaagacagataatgatttgaaaagagcaatggattatatattt
aatcacgacttagaagctgagatgaatcagacacaagcgaagtagtaataacagaagtag
gatcaatttgataatcaaacatcaaaatactaattgtttgcgtgtatagtccatttagga
aaatctgttcaaagtggacattatgtgtcttacattaaaaagaatggagaatggattctg
tacaatgattctaaggttgccaagatagctgatcctgctttaaacaagggttatatgtat
atcttcaagagactagattga

DBGET integrated database retrieval system