KEGG   Paramecium tetraurelia: GSPATT00018377001Help
Entry
GSPATT00018377001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
ptm  Paramecium tetraurelia
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GSPATT00018377001
Enzymes [BR:ptm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     GSPATT00018377001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 351 aa AA seqDB search
MQQSQYQICVLGSANSDHFLEVEDFPKEGETIASKKSYLKNGGKGANQAVASALLKSKII
FAGQIGKDELGQLLVKEMTLAGVDLTALRKVDEQTGQAIILLNKKGENLIIIVAGANGYY
ETLDVLPQEYQQAIESSDLLQLQMEVPQSINILAAKYMSQNDKITVLDCGGKAEKLKSDF
LEKLTIVSPNETELERILGEDLNMDADSNAEEFLTKTIHDKVFTRYPDLIVLLKLGSNGS
MLVTKGYSVRCQTVTQLNPNILEEYKIVDTVGAGDCFTSAFTVSFYNSLIEFGPARISTL
RKIDVETQKKLFYKAMHFGSASAFLCITKHGAMPSMPKFETVDNFIKKYFP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgcaataatctcaatactagatctgtgtgttaggaagtgcgaattctgatcatttcctt
gaagttgaagactttcctaaagaaggagagactatcgcttctaagaaatcctatttaaaa
aatggaggcaagggggctaatcaagcagttgcatcggctctgcttaaatccaagatcatc
tttgcaggtcaaattggaaaggatgagcttggctaattgttagtcaaagaaatgacattg
gcaggagtagatttaactgcccttagaaaagtagatgaataaacaggataggccataatt
ctgttaaataagaaaggagaaaatcttatcatcatcgttgcaggagctaatggatattat
gaaaccttggatgtcttaccacaggaataccaataagctattgaatcatcagatttattg
taattacaaatggaagtaccacagtccatcaacatcttggctgctaaatatatgagccaa
aatgataagattacagttttggattgcggaggcaaagctgagaaattaaagagtgatttc
cttgagaaattgacaattgtgagtcccaacgaaacagaattggagcgtatcttaggagaa
gatcttaatatggatgcagattcaaatgcagaagagtttcttaccaaaaccatacatgac
aaggtgttcactcgttatccagatttaattgttctattgaagttaggttcgaatggaagt
atgcttgtgactaaaggatatagtgtaagatgtcaaacagtgacacaattaaaccctaac
attttggaagagtacaaaatcgtcgatactgttggtgctggtgattgtttcacttctgca
tttactgtgtcattttacaattccttaattgagtttggaccagccagaatttcaactctg
agaaagatagacgttgaaacacaaaagaaattgttctacaaggccatgcatttcggaagt
gcttctgcattcttgtgcattactaaacatggtgctatgccatcaatgccaaagtttgag
acagtagacaatttcatcaagaagtatttcccatga

DBGET integrated database retrieval system