KEGG   Paramecium tetraurelia: GSPATT00018642001Help
Entry
GSPATT00018642001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
ptm  Paramecium tetraurelia
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    GSPATT00018642001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     GSPATT00018642001
Protein phosphatases and associated proteins [BR:ptm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     GSPATT00018642001
Transcription machinery [BR:ptm03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     GSPATT00018642001
Spliceosome [BR:ptm03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    GSPATT00018642001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 1310 aa AA seqDB search
MAKDKQGEIDVDNIIERLLSVRGSKPGKNVNLTEPEVRGLCIKARDIFISQPILLELEAP
LKICGDVHGQYFDLLRLFEYGGYPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENF
FLLRGNHECASINRIYGFYDECKRRYTIKLWKTFTDCFNCLPVAALIDEKILCMHGGLSP
ELSNLEQIRRIMRPTDVPDTGLLCDLLWSDPDKDVQGWADNERGVSYVFSQEIVQVFLKK
HELDLICRAHQVVEDGYEFFSKRQLVTLFSAPNYCGEFDNAGSMMTVDESLMCSFQILKP
AEQGAQGASQQNKPPSAKFVNLIQIREFIYNLKQLKQTNQSFIMFSDLIDQFRQTYQNKY
LTLLEFSNILDQYARLDIRCDLDDNVKEQLYKFIKEKQQNVTYCALETVILEFLLQQEVI
QPQAQINVDTLGKCARRLPLDMLQNINNDFLLQFKNFYKLISNKYGSHVDYRELERLGKE
LQRTIKINSVEIMRYIQPFVDTQQKVKIDEILELSNDLERLINDQNRIQSKGVEGRKSNT
IEQLAEDYHYSSEEDNQKQINVISTASNDRRNFTNIIYQQTDLIKQKFINKAGLSCLTEI
NKATQSIEGLITNLINDIDIKNKKIDELIIEKELTSGQLQQFELEIQNKDQQIQMCLQDN
DMFQTQINQCQDQNKDLKIQLNFYNEELKSITRLETELKEMQLDTRNLKEQLNKLNKENT
RLQLNNKSLMEIIEELETKSQQNKDIDTIKQSLQQHKEQICQLELKLDDLQKQNQQLEEL
NLSYEKIKEGLEQQIIELKREVSHYKKMFENTNIENQQLRSSIIPRTSMFNSQQMNGGGL
GRLSKMSIGGGMTSSKIYIIGRNSSQRMSSIRPNQYGSTFNPLEEIQSGPLKIEEVQDLD
NQSPDQQKVHSNKPAMINSRMDARINPKYENSIVEVINEENEEKEQVGTVVEKPKENQLL
QQFDKFWGGLGTKNLEELAPDTQQIKIDENILYYRDFLGIRDDPKIMEYLKLEKNIYKSI
IQRCFSDGVYRIDAKGKKARRILFLTEHTFYIFEGEKKPSKLSRSFPLKNIHTLVFSEAS
PVICCIKVAGSDDYLIETFKRSELNSFLTEIFASQKITLFKVEFLAQFKIKMKGLKDEIP
ISQVIKKQTSQDQGKTPTFRVSSKQGLYSQNMGWLQLFKKKMFQGDWQEVFVILTNVGLV
LFKKPGDAEPILFVSFVEAVVIKNPLFDTSKQHTIKVTILIPLRSVMKIVIPNSCSMQPQ
VFFQINGMMPSKMQSWNKCDNRISIWYISNNKWWNIEIKLNWINETILLN
NT seq 3933 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaggataaatagggggagatcgatgtagataacataattgagagattactcagt
gtcagagggagcaagccaggaaaaaatgtaaatttgacagaacctgaggttagaggtctt
tgtataaaagcaagagacattttcatcagctagcctatattattggaattagaggcacct
ctgaagatttgtggcgatgtacacggtcaatatttcgatcttttgagattatttgagtat
ggtggttatcctcctgagagcaattatctttttttgggggattacgtagatagaggtaaa
taatccttggagactatttgtttactgttggcatacaaaattaaatacccagagaacttt
ttccttttgagaggtaatcatgaatgtgcatccatcaatagaatctacggtttttacgat
gaatgtaaacgtcgatatacaattaaattatggaaaacattcacagattgctttaattgt
ttacctgtggcagctctgatagacgagaaaattctatgcatgcatggaggtttgtctccc
gaattgtctaatttggagcaaataagaagaataatgaggcctactgatgttccagataca
ggcctcctatgcgatttgctttggtcagatccagataaggatgtataaggatgggcagat
aacgagagaggagtttcgtatgtgtttagttaagaaattgtgcaggtgttccttaaaaag
catgaattagatcttatttgtagagcccattaggtagttgaagatggctatgaattcttt
agtaaaagataattggtgactctgttttcagctccaaattattgtggtgagtttgataat
gcaggttctatgatgactgttgatgaatcccttatgtgttcgttccaaatactaaagcct
gctgaacaaggtgctcaaggtgcatcacaacaaaacaaacctcctagtgccaagtttgta
aacctgatttaaatcagagaatttatatataatttaaaacaacttaaatagactaattaa
tcatttattatgttttcagacttgatcgatcagttcagataaacttatcagaataaatac
ctaacacttcttgagttttcaaacatattagatcagtatgccagattggatataagatgt
gatttggatgataatgttaaagaatagctgtataagtttatcaaggagaaataacaaaat
gtgacttattgtgcacttgaaactgtcattcttgaattcttattacaataggaagtgatt
caaccctaagcttaaattaatgttgacactctgggtaaatgtgctcgtcgattgcctttg
gatatgttacagaacatcaataatgattttcttctgcaattcaaaaatttctataagttg
atctccaataagtatggcagtcatgttgattatcgtgagttagaaaggttgggtaaggaa
ttgtagagaactatcaaaataaattctgttgaaataatgagatacatccaaccatttgtg
gatactcaatagaaagttaaaatagacgagattcttgaactttccaatgaccttgagaga
ttgattaatgatcaaaatagaatacaatccaaaggggttgaaggcagaaagtcaaacaca
atcgagtaattggcagaagattatcattattcaagtgaggaagacaattaaaaataaatt
aatgtgatttccactgcatcaaatgataggagaaactttacaaatatcatatatcaatag
accgatttaattaaatagaagtttattaataaagcaggtctttcctgtctaactgagata
aacaaagccacttaaagcatcgaaggattgattaccaatttgattaatgatattgacatc
aagaataaaaagatagatgaactgattattgaaaaggaattgacctcgggataattataa
tagtttgagctagaaattcaaaataaggattaatagattcaaatgtgtttacaagataat
gatatgttttaaactcaaattaattaatgtcaagatcagaataaagatctaaaaatacaa
ctcaacttttacaatgaagaattgaaaagtataacgagattggagacagaattgaaggaa
atgtaattagataccagaaatctaaaagaacagttaaataagttgaataaggaaaatact
agattgcaattgaataacaaatcattaatggaaattatagaagaattagagaccaaatct
caatagaataaagatatagatactattaagcaatccttataacaacataaagaataaata
tgttaattagaactcaaattagatgatttatagaaacagaaccaataattagaggagttg
aatttgagttatgagaaaattaaggaaggacttgaataatagataatagaattgaaaaga
gaagtatctcattataaaaagatgtttgaaaatacaaatattgaaaactaatagttgaga
agtagtattattccaagaacaagtatgttcaactcataatagatgaatgggggtggtctt
gggagattgagcaaaatgtcaataggaggtggtatgacatcttctaagatttatataatc
ggccgaaattcatcgcaacgaatgtcttcgatcagacctaatcaatatgggagcaccttt
aatcccttggaagaaatacaaagcgggcctctgaagattgaggaagtttaggatttggac
aattagagtccagattaataaaaagttcatagtaacaaaccagctatgataaatagtagg
atggatgcaagaatcaatccaaaatacgagaatagtattgtggaagtgataaatgaggag
aatgaagagaaggaacaggttgggacagttgtagagaagccaaaagagaatcaactatta
caataatttgataagttttgggggggattgggaaccaagaatttagaggaattggctccg
gatacgcagtagataaagatcgatgaaaacattttatattatagagactttttggggatt
agagatgatcccaagattatggaatacttgaaattggagaagaatatatacaaatcaata
atatagaggtgtttttctgatggagtttatagaatcgatgctaaagggaaaaaggctaga
agaatcctatttttgacagaacatacattctatatatttgagggagaaaagaaaccatct
aaattgtcaagatcatttccattaaaaaacatacatactttggttttttcagaggcttca
cctgtcatttgttgtatcaaagtagcaggttcagatgattatttaattgaaacatttaaa
agaagcgaattaaattcatttttaactgaaatatttgcatcctaaaagattaccttattt
aaagtggaattcttggcttagtttaaaataaaaatgaaaggactcaaagatgaaatcccc
atttcttaagtcattaaaaagtagacaagtcaagatcaaggaaagactccaacattcaga
gtgagttccaaataaggattatactcgtagaatatggggtggttgtagttattcaaaaag
aaaatgttccaaggtgattggtaagaagtctttgtgattttaacaaatgtcggattggtc
ttatttaagaaaccaggtgatgcagaacctatactcttcgtatcctttgtagaggctgtt
gtaattaagaatcccctttttgatactagtaaataacatacaattaaagtaaccatttta
attccacttagatccgttatgaaaattgtgattccgaattcgtgttcaatgcaacctcaa
gtcttcttttagatcaatggcatgatgccatctaaaatgcaatcatggaataagtgcgat
aatagaattagtatttggtacatcagcaacaacaagtggtggaacatcgaaattaaacta
aattggatcaatgaaacaatactattaaattga

DBGET integrated database retrieval system