KEGG   Paramecium tetraurelia: GSPATT00019169001Help
Entry
GSPATT00019169001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
ptm  Paramecium tetraurelia
Brite
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     GSPATT00019169001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 443 aa AA seqDB search
MQLIVLKSQQQNSQTLFGRMNLFKQKVTYYYDEEFGTYNYSTTHPMKPLRVAITDDLVGH
YGLKQYMNCIDQSFVQTYIKRVDEDVLTQFHSYEYIDLIKIITPENKCQYEDQLYRFNFM
EDCPVLDRLFDFCLCQTSGSVGAACVIADQKSNIAINWSGGLHHAKQSEASGFCYVNDCV
LGILELLKTYQRVLYVDIDIHHGDGVEEAFYLTDRVMTCSFHKFKEYFPGTGHIDDVGHD
KGKYYAVNFPLNEGLNDDSIQHIFKPVIDKIMENFRPDVVMLQGGTDSLSGDRLGCFNLS
IKGHGTCIEYLKKFNVPIIMVGGGGYTLRNVPRCWTYETSLALNVPIQDNIPDESEYKVY
FGPEYKLHLPISNMEEQNSKDYLEKNIVQILENLKQITPGCAQIDHHAIGKESRQKVDYQ
ELFSEYRDNREEMQIEQNQDIQE
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtaattaatcgtgttaaaaagtcaataataaaattcttaaactttatttgggaggatg
aatctctttaagtagaaagtgacatactactatgatgaagaattcgggacatacaattat
tctacaacacatccaatgaagccattaagagtggccattactgatgatttagtcggtcac
tatggattgaaataatatatgaattgtattgattaatcttttgtgtaaacatacataaaa
agagtagatgaagacgtactaacttaatttcattcttatgaatacatagatttaattaag
ataatcactccagaaaataaatgtcaatatgaggaccaactttatagatttaattttatg
gaggattgtccagtcttagataggttgtttgatttttgcttatgctaaacttctggatca
gttggagctgcttgtgtaattgcagatcaaaagagcaacattgccatcaactggagtgga
ggattacatcatgccaagtaaagtgaagctagcggattctgttatgttaatgattgtgtg
ttagggatattagaattattgaaaacctattagcgagttctgtatgttgatattgatatt
catcatggagatggagtagaggaagccttctatttaactgacagagtgatgacatgttct
tttcataaatttaaggaatatttcccaggaactggtcatattgatgatgttggacatgat
aaaggaaaatattatgccgtcaatttccctttaaatgaagggttaaatgatgactcaatc
taacatattttcaaaccagtcattgataaaattatggaaaatttcagacctgatgttgta
atgttacaaggaggtacagatagtcttagcggtgatcgtttagggtgtttcaatttaagt
attaaaggacatggcacttgcattgagtatttgaagaaattcaatgttccaataataatg
gttggaggaggaggatatactcttcgaaatgtccccagatgctggacatatgaaacttca
cttgctttgaatgtgccaatataagataatattcctgatgaatcagaatacaaagtctat
tttggacctgaatataaattacatttaccaatttcgaacatggaagagtaaaattctaaa
gattatttagaaaaaaatattgtttaaattctagaaaacctaaaataaataacccctggg
tgtgcttaaattgaccatcatgctattggaaaggaaagcagatagaaggttgattattaa
gaattgttttctgagtatagagataatagggaagaaatgcaaatagaataaaattaagat
atataagaatga

DBGET integrated database retrieval system