KEGG   Paramecium tetraurelia: GSPATT00019371001Help
Entry
GSPATT00019371001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
Organism
ptm  Paramecium tetraurelia
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Mad3_BUB1_I
Motif
Other DBs
NCBI-GeneID: 5038836
NCBI-ProteinID: XP_001453051
Genoscope: GSPATT00019371001
UniProt: Q3SEC7
Position
undetermined
AA seq 318 aa AA seqDB search
METKKVKLADYDIMNTLGTGSFGRVRLAKQKSNNKYVALKMLKKIEILRLKQVDHIISEF
NILKQVKHPFLIEMSGYTQDERYLYFVLEYIQGGELFTYLRNAGTVQNEEAQFYSAQVVL
MFEYLHTKNIVYRDLKPENLLVQSDGYLKLTDFGFAKVVEDRTYTLCGTPEYLAPEILLN
KGHSKPVDWWCLGIFLYEMLAGIDPFNDEDPMAIYQKILKGKVKYPRNFDNEAKSLVKHL
LEQDVTKRFGNLKNGVDDIKQHKWYETLNWKDLFAKKLKPQYIPVIQSDYDTSNFATYPD
STELPDSIKQQDDPFKDW
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atggaaacaaaaaaggttaaattagctgattatgacataatgaatacattggggactggt
tcatttggaagagtaagattagcaaaacaaaaatcaaataacaaatatgttgctttgaag
atgctaaaaaaaattgaaatattacgacttaaataggttgatcatattataagtgaattt
aacattctcaagtaagtaaaacacccatttctgattgaaatgagtgggtacacttaagat
gaacggtacttgtattttgtgttggagtacatataaggaggagaattgtttacatactta
agaaatgctggaacagtacaaaatgaagaggcttaattctactcagcctaagttgtttta
atgtttgagtatcttcacactaagaatatagtgtatagagatttgaagcctgaaaatctt
cttgtctaatctgatggttatctgaaactaactgattttggttttgctaaagtggttgaa
gatagaacctatacattatgtggtacacctgaatatttggcacctgaaatcctattaaat
aaaggtcatagtaaacctgtagattggtggtgtttaggaatctttttgtatgaaatgctt
gcaggaattgatccatttaatgatgaagatccaatggctatatattagaaaatattgaag
gggaaagtcaaatatccacgtaattttgataatgaagcaaaaagcttagtaaaacattta
ttggaataggatgtaacaaaaagatttgggaatttaaaaaatggtgtagatgatattaaa
taacataaatggtatgaaactctgaattggaaagatttgtttgccaaaaaactaaagcca
caatatataccagttattcaatctgattatgatacttctaattttgctacttatcctgat
agtactgaattaccagactctattaaataataggatgatccattcaaagattggtga

DBGET integrated database retrieval system