KEGG   Paramecium tetraurelia: GSPATT00019454001Help
Entry
GSPATT00019454001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
ptm  Paramecium tetraurelia
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSPATT00019454001
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    GSPATT00019454001
Enzymes [BR:ptm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     GSPATT00019454001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 514 aa AA seqDB search
MNRLSQLSGQFDEEQKLLQQITELENWFKSPRFNNVLRPYTAKQVAEVRGSIVPNQFSDF
MARKFYTLMMDLKQSKGFSLACGALDTVQVINMSKYMTSIYVSGWQCSSSASTTNDPGPD
FADYPYDTVPKKCDQLVKMQRFQDRRQQYERSLITAEQRKQKKPYDYLVPVICDADAGFG
GTSSVMKLTKLFIESGAAGIHLEDQRPDLKKCGHMAGRVVTSTNTHVQKLIASRLQADIM
GNELFIIARTDALGARFIETNVDLIDQPYILGVTKFHDKPCTYPEAGVFIIEQMIDKEKR
IQATNQWLKQCESGGIKRAKDLAKRLGFELDFDWEQCRNPDGFYALKSSVHYCAIRAKEY
LKYADALWMETSTPDLKVAKELSDELQFELQNNKVLCYNCSPSFNWSKFGFSDSELKNFN
SELGKLGYTWQFITLAGFHLNALQSERFSKDLSERYMLAYVEDIQRKEEKHNVDQLRHQK
WSGAELIDHVMTIVNQSTLISSGEDSTEHQFDNK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaatagattatcctagttgagtggacaatttgatgaggaatagaaattgctccagcaa
ataactgaattggaaaattggttcaagagtccacgtttcaataatgttttgcgtccatac
acagccaaataagttgctgaagtaagaggatcgattgtacctaatcaattctctgatttc
atggcaagaaaattctacactctcatgatggatttaaaataaagcaaaggcttctctctt
gcatgtggagccttagatactgtgtaagttatcaatatgtccaaatacatgacatctatt
tatgtatcaggttggcagtgctcatcttcagcttcaactactaatgatccaggtcctgat
tttgctgattacccatacgacacagtgcctaagaaatgtgatcagctagtcaaaatgcaa
agatttcaagacagaagatagtagtatgaaagaagtctaattacagctgaataacgaaaa
taaaaaaaaccttatgattatctagttccagttatttgtgatgcagatgctggatttggt
ggtacaagcagtgttatgaaattgacaaaattatttattgaatctggagctgcaggaatt
catttggaagatcagagacctgatttaaagaaatgcggtcacatggctggaagagttgtt
acatctactaatactcatgtctaaaaactcatagcttctcgacttcaagctgacattatg
ggaaatgagttattcattattgccagaactgatgcattaggagcaaggttcatagagacc
aatgtggatttgattgattaaccatacattctaggagttaccaagtttcatgataaacca
tgcacttatccagaggcaggagtttttatcattgaacaaatgattgacaaagaaaagaga
atacaagccactaattaatggttgaaataatgtgaatcaggtggaatcaaaagagccaaa
gacttagcaaagagattgggatttgaactcgatttcgattgggaacaatgtagaaatcct
gatggattctatgctcttaagagtagtgtgcattattgtgcaataagagccaaagaatac
ttgaaatatgcagatgctttatggatggagacttcaactcctgatctgaaggttgctaag
gaattatctgatgaattacaattcgaacttcagaataacaaagtcctttgttacaattgt
tctccaagttttaattggagcaaatttggattctcagacagcgaactcaaaaactttaat
tcagaactagggaagttaggatacacttggcagtttattacgttagcgggatttcatttg
aatgcactacaaagtgaaagattctccaaggatctatcagaaagatatatgctggcttat
gtggaagatatttagagaaaagaggagaaacataatgttgattaattgagacatcaaaaa
tggtctggagctgaattaattgatcatgtcatgactattgttaatcaaagtacattgata
tcttcaggcgaagactcaactgaacattaattcgacaataaatga

DBGET integrated database retrieval system