KEGG   Paramecium tetraurelia: GSPATT00019551001Help
Entry
GSPATT00019551001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ptm  Paramecium tetraurelia
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    GSPATT00019551001
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSPATT00019551001
  Amino acid metabolism
   00310 Lysine degradation
    GSPATT00019551001
Enzymes [BR:ptm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GSPATT00019551001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 397 aa AA seqDB search
MRQFAVSLFKVSQTQFAQIPKFYFSKKVVNVPTMGDSITEGDVKELQKKVGDYVNQDDVI
ALIETDKVTIDIRCADSGLITQMFAADGAKVEVGKPFYEIDTTAAKPAGAAATPETKKEE
KKEQKQEVKQEQKQEAPAAQKSTPPPAAKPAEKKPVAPSVTTPTQRTEKREPMSRMRQRI
AQRLKDAQNTYALLTTFQECDMSAVMEAREAMQKDFQKKHNVKLGFSSFFIKAAVKQLQE
QPIVNAVIDGTDIVYRNYIDISMAVATPTGLMVPVLRNCERLSFADIEKTLIDLAEKGRQ
GKISADDMVGGTFTISNGGVFGSLMGTPIINAPQSAILGMHAIVNRPVVRNDQIVARPMM
YLALTYDHRILDGKDAATFLKKLATSIEDPRRILLDV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagatagtttgcagtctctttgttcaaagtatcgtaaacacaatttgctcaaatacca
aaattctatttctcaaaaaaggtagtgaatgtgcctacaatgggtgattcaattacagaa
ggagatgtcaaggaattgcaaaagaaggtgggagattatgtgaatcaagatgatgtgatt
gcattgatagagacagataaagtcaccattgacatcagatgtgcagactcaggattgatt
acataaatgtttgctgctgatggtgctaaagttgaagttggcaaacccttttacgaaatc
gatactacagctgctaagccagctggtgcagcagcaactccagaaactaagaaggaagaa
aagaaagaataaaagcaagaagtgaaataagaataaaagcaagaagcacctgcagcctaa
aagagcactcctcctccagctgcaaaacctgctgagaagaaacctgtggctccatctgtt
acaactcccacttagagaacagaaaaaagagaaccaatgtcaagaatgagacaacgcatc
gcttagagattgaaggatgcttagaatacttatgcattgcttaccactttttaggaatgt
gacatgagtgctgttatggaggcaagagaagccatgtagaaggatttctaaaaaaagcac
aatgtcaaattggggttcagttcattcttcattaaggctgctgtcaaacaattgcaagaa
caacccattgtcaatgcagttatcgatggcaccgatattgtttatagaaattacattgat
atttctatggctgttgccacacccactggactcatggtaccagtactcagaaattgcgaa
cgtctcagtttcgctgatatcgaaaaaacacttattgatttagctgaaaaggggagacaa
ggaaaaatctccgcagacgacatggtcggtggtacattcacaatctcaaatggtggagtt
tttggaagtttgatgggaacaccaatcattaatgctcctcaatctgccattttgggaatg
cacgctattgtcaatagaccagttgtcagaaacgattaaattgttgctcgtcctatgatg
tatcttgccttgacttatgatcacagaattcttgatggaaaggatgctgccactttcctt
aagaaattagctacttcaattgaagatccaagaagaatattattagatgtttga

DBGET integrated database retrieval system