KEGG   Paramecium tetraurelia: GSPATT00019551001Help
Entry
GSPATT00019551001 CDS       T01055                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ptm  Paramecium tetraurelia
Pathway
ptm00020  Citrate cycle (TCA cycle)
ptm00310  Lysine degradation
ptm01100  Metabolic pathways
ptm01110  Biosynthesis of secondary metabolites
ptm01130  Biosynthesis of antibiotics
ptm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GSPATT00019551001
  Amino acid metabolism
   00310 Lysine degradation
    GSPATT00019551001
Enzymes [BR:ptm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     GSPATT00019551001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 CENP-N Coilin_N Peptidase_C37 Presenilin
Motif
Other DBs
NCBI-GeneID: 5039029
NCBI-ProteinID: XP_001453244
Genoscope: GSPATT00019551001
UniProt: A0DS30
Position
undetermined
AA seq 397 aa AA seqDB search
MRQFAVSLFKVSQTQFAQIPKFYFSKKVVNVPTMGDSITEGDVKELQKKVGDYVNQDDVI
ALIETDKVTIDIRCADSGLITQMFAADGAKVEVGKPFYEIDTTAAKPAGAAATPETKKEE
KKEQKQEVKQEQKQEAPAAQKSTPPPAAKPAEKKPVAPSVTTPTQRTEKREPMSRMRQRI
AQRLKDAQNTYALLTTFQECDMSAVMEAREAMQKDFQKKHNVKLGFSSFFIKAAVKQLQE
QPIVNAVIDGTDIVYRNYIDISMAVATPTGLMVPVLRNCERLSFADIEKTLIDLAEKGRQ
GKISADDMVGGTFTISNGGVFGSLMGTPIINAPQSAILGMHAIVNRPVVRNDQIVARPMM
YLALTYDHRILDGKDAATFLKKLATSIEDPRRILLDV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgagatagtttgcagtctctttgttcaaagtatcgtaaacacaatttgctcaaatacca
aaattctatttctcaaaaaaggtagtgaatgtgcctacaatgggtgattcaattacagaa
ggagatgtcaaggaattgcaaaagaaggtgggagattatgtgaatcaagatgatgtgatt
gcattgatagagacagataaagtcaccattgacatcagatgtgcagactcaggattgatt
acataaatgtttgctgctgatggtgctaaagttgaagttggcaaacccttttacgaaatc
gatactacagctgctaagccagctggtgcagcagcaactccagaaactaagaaggaagaa
aagaaagaataaaagcaagaagtgaaataagaataaaagcaagaagcacctgcagcctaa
aagagcactcctcctccagctgcaaaacctgctgagaagaaacctgtggctccatctgtt
acaactcccacttagagaacagaaaaaagagaaccaatgtcaagaatgagacaacgcatc
gcttagagattgaaggatgcttagaatacttatgcattgcttaccactttttaggaatgt
gacatgagtgctgttatggaggcaagagaagccatgtagaaggatttctaaaaaaagcac
aatgtcaaattggggttcagttcattcttcattaaggctgctgtcaaacaattgcaagaa
caacccattgtcaatgcagttatcgatggcaccgatattgtttatagaaattacattgat
atttctatggctgttgccacacccactggactcatggtaccagtactcagaaattgcgaa
cgtctcagtttcgctgatatcgaaaaaacacttattgatttagctgaaaaggggagacaa
ggaaaaatctccgcagacgacatggtcggtggtacattcacaatctcaaatggtggagtt
tttggaagtttgatgggaacaccaatcattaatgctcctcaatctgccattttgggaatg
cacgctattgtcaatagaccagttgtcagaaacgattaaattgttgctcgtcctatgatg
tatcttgccttgacttatgatcacagaattcttgatggaaaggatgctgccactttcctt
aagaaattagctacttcaattgaagatccaagaagaatattattagatgtttga

DBGET integrated database retrieval system