KEGG   Paramecium tetraurelia: GSPATT00019973001Help
Entry
GSPATT00019973001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K13998  
dihydrofolate reductase / thymidylate synthase [EC:1.5.1.3 2.1.1.45]
Organism
ptm  Paramecium tetraurelia
Pathway
Pyrimidine metabolism
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ptm00240]
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ptm00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:ptm00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 462 aa AA seqDB search
MTTNKTFSMVLAMTLNGGIGYQNRLPWKLKEDLQRFKKITTGGIVIMGRKTFESMNSKPL
PNRVNVVISKNMKSSNEVQVFPRIEDALQFYNTSHQKLYLIGGKRIFEEGLATDKCSDVH
LTRIGVETKCDVYLNKNIFSTFQVNKTSQTKSENGINYDYQHLINKNSHEQSYIDEEHQE
NQYLDMITKIMKEGVSKDDRTGVGTMSIFGQTMRFNLAQSFPLLTTKKVFFRGVVEELLW
FLRGNTNGKLLLDKGVKIWEGNGTREYLDTIGLQHRQEHDLGPVYGFQWRHFGAKYKDCQ
TDYSNQGVDQVKEIIQLLKNNPDSRRIILSAWNPIDLKQMALPPCHVMSQFFVANGKLSC
MMYQRSCDFGLGIPFNIASYALLTYMLAKECNLNLGEFVHVLGDTHIYSNHVEALKKQIE
RVPYPFPLLKIKGNKSLFDYTYEDFELVGYNAHDKIEMKMAV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgactactaataaaacatttagtatggtattagcaatgactctcaatggaggcataggg
tattagaatagattgccttggaaattaaaggaagatcttcagagattcaagaaaatcaca
acaggcgggattgtgataatgggaagaaagacattcgaatcgatgaactctaaacctcta
ccaaacagagtgaatgtagtgatttcaaaaaatatgaaatcatctaatgaagttcaagtg
tttcctagaatagaagatgcattacaattttacaatacatctcatcagaaattatattta
ataggaggaaagagaatctttgaagaaggtttagcaactgataaatgttcagatgttcat
ttgactagaataggagtagaaactaagtgcgatgtgtatttgaacaaaaatattttctct
acattttaagtgaataagacaagttaaactaaaagtgaaaatgggatcaattatgattat
caacatttaattaataagaattctcacgaacaatcatatatagatgaagaacattaagaa
aatcaatatttagatatgataacaaaaataatgaaggagggagtctcaaaggatgacaga
actggagtaggtaccatgtctatttttgggtaaactatgagatttaatttggcctaatcc
tttcctttattaacaacaaagaaagtattctttcgtggagttgttgaggaattgctatgg
tttttaagagggaatacaaatggtaaattacttttggataagggagttaagatatgggaa
ggaaatggcacccgagaatatttggataccattggtttataacatagataggaacatgac
ttaggaccagtctatggatttcaatggagacattttggagctaaatataaggattgttag
actgattattccaattaaggagtggattaagtgaaggagattatacaattactgaaaaac
aatccagatagtagaagaataatattatcagcttggaatccaattgatttaaaataaatg
gcattgccaccatgtcatgtgatgtcataattctttgtggcaaatggcaaattgagttgc
atgatgtattagagatcatgtgactttggtttgggaattcccttcaatattgctagttat
gcattgctcacttacatgttggcaaaggaatgcaatttgaatttgggagaatttgttcat
gttttaggagatactcatatttatagtaatcatgtggaggctttaaagaaataaattgag
agggttccttatcctttcccacttctgaaaatcaagggtaataagagtttgtttgattac
acttatgaagattttgaattggttggatataatgctcatgataaaatagaaatgaaaatg
gctgtttga

DBGET integrated database retrieval system