KEGG   Paramecium tetraurelia: GSPATT00019998001Help
Entry
GSPATT00019998001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K00721  
dolichol-phosphate mannosyltransferase [EC:2.4.1.83]
Organism
ptm  Paramecium tetraurelia
Pathway
N-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    GSPATT00019998001
Enzymes [BR:ptm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.83  dolichyl-phosphate beta-D-mannosyltransferase
     GSPATT00019998001
Glycosyltransferases [BR:ptm01003]
 N-Glycan biosynthesis
  Dol-P-Man biosyntheisis
   GSPATT00019998001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 236 aa AA seqDB search
MSKYSVILPTYNERENLPIITYLIFEMAKKNNLDFEIIIIEDNSPDGTLQVAQELKKVYG
DKLIIHFREKKLGLGSAYMDGIKLCHGNFIVIMDADLSHHPKYLVDFIKKQKTTNCDIVT
GSRYIDKGGVMNWGFDRKLTSRGANFLASTTLGVKCSDLTGSFRLYKREVLEKVIKDVVS
RGYAFQMEIIIRARQYGYTVEEVPIVFVERIFGESKLGASEFQIYLKGLWKLLWTF
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaatattctgtaattctgcccacttacaatgaaagagagaatttaccaatcatc
acttacttgatctttgagatggctaaaaagaacaatttagattttgagatcatcataatt
gaggacaactcccctgatggcactctacaagtagcataagagttgaagaaagtatatggg
gataaattgatcatccattttagggagaaaaagttgggtttagggtctgcttatatggat
gggatcaaactttgccatggcaattttattgtcattatggatgcagatttatcacaccat
ccaaaatatttggtggacttcatcaaaaaatagaaaacaacaaattgtgacattgtgaca
ggatcaagatacattgataaaggaggtgttatgaattggggattcgatagaaaacttaca
tctagaggtgccaatttcttagcatccactacattgggagtcaagtgttctgatctaaca
ggaagtttcagactctacaaaagggaagttttagagaaagttattaaagatgtagtttca
agaggatatgcatttcaaatggaaataatcattagagctagacaatatggttatacagta
gaggaagtaccaattgtttttgttgaaagaatctttggagaatcgaaattaggggcatct
gaatttcaaatatacttaaagggattgtggaagttgctctggacattctga

DBGET integrated database retrieval system