KEGG   Paramecium tetraurelia: GSPATT00020781001Help
Entry
GSPATT00020781001 CDS       T01055                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
ptm  Paramecium tetraurelia
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ptm00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    GSPATT00020781001
Enzymes [BR:ptm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     GSPATT00020781001
Peptidases [BR:ptm01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   GSPATT00020781001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Genoscope: 
UniProt: 
Position
undetermined
AA seq 472 aa AA seqDB search
MGLCTSKDAVSESSIRRVHPLNMENSVVLTINYAKIPNKFKRLPQNKSCGLIGLQNLGNT
CYINAAIQCLSNTQPLTEYFQQNLHNHELNIENPLSSRGQITNAYARLICSLWKESYQKS
INPIELISMIQLWNPFFVMNSQQDSHELLAFLLDMLHEDLNRVKHKPYIEEKTYDQQPNQ
QQANKAWSDYLKRNRSIIVDLFQGQSINMLQCMVCNTKSYKFETFMYLSLPIQQDADLIQ
CISEYLREEELDEANQWHCSKCKSVKKSKKGIKLWKLPNILVIHLKRFKFTANYRCKLRW
LINFPMYNLDLSNYSEQEQATYDLYGVINHSGTLHSGHYTSNCKNKDTQKWYNFDDTRIK
EIMEKEVLTSDAYLLFYYKNSVDSYERQSEVIRSSIINSSASLPKQSSIIHGSYFNIPHT
KLSISKLCISETDQQLTTPQIFGKKKSLKTNKLTPLPGKKPIFFASDNQKIQ
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgtgtacaagtaaagatgctgtgagtgagagttcaataagaagagttcatcct
ttgaatatggaaaacagtgttgtgttgactattaattatgcaaagattccaaataaattt
aaacgattaccttaaaataaatcatgtggtttaatagggttataaaatttaggaaacact
tgttatattaatgctgctatataatgcctatcgaatacataaccacttacagaatatttt
caatagaatcttcacaatcatgagttgaatatcgagaatccattatcaagcagaggtcaa
atcacaaatgcttatgctagattgatatgttctctttggaaagagtcatattagaagagc
attaaccctattgaattgatatcaatgatccaattgtggaatccattctttgttatgaat
agtcaacaagatagccatgagttgttagcgtttttgttagatatgctgcatgaagacttg
aatagagtgaaacataaaccatacattgaggagaagacatatgattaacagccaaattaa
taataagcaaataaggcatggtcagattatttgaaaaggaatcgatcaatcattgtggat
ttattctaaggacagtccataaacatgttgtaatgcatggtatgtaatacaaaatcatat
aaatttgaaacatttatgtatctaagtctgccgatctaataggatgctgatttaatataa
tgcatatctgaatatttgagagaggaggagttggatgaagcaaatcaatggcattgttct
aaatgcaagtctgttaagaaaagcaaaaaagggataaaactatggaaattgccgaatatc
ttagtgatccatctaaagcgatttaaatttacagccaattatcgttgcaaactgagatgg
ctaatcaactttccaatgtataatttagacctaagcaattattcagaataggaataagcc
acatatgatctatatggagttataaaccatagcggtactttgcattcaggtcattataca
tccaattgtaaaaataaggatacttagaaatggtataacttcgatgacacaagaattaaa
gagattatggaaaaagaagttctcactagtgatgcctatttgctattttattataaaaat
agtgtggattcctacgaaagacaaagtgaagttataagatcaagtataataaattcatcg
gcatcccttccgaaatagagcagtattattcatggtagctatttcaatataccccatacc
aaattatcaataagcaaattatgtatatctgaaactgactaataattaacaactcctcaa
atatttgggaagaaaaaaagtctaaaaactaacaaattaactccacttcctggcaaaaag
ccaatattctttgcatcagataattaaaagatataatga

DBGET integrated database retrieval system